SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310837|ref|YP_007121814.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310837|ref|YP_007121814.1|
Domain Number 1 Region: 26-169,207-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.16e-51
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 471-525,557-586
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000282
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Weak hits

Sequence:  gi|428310837|ref|YP_007121814.1|
Domain Number - Region: 380-461
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000286
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310837|ref|YP_007121814.1|
Sequence length 849
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSHSLNKDCHYRNHLLTSAIILSSLCLNYPLQAQIVPDNTLLFNSLTTQSGNTSIITGGT
PAGSNLFHSFSQFSVPTGGTAYFNNSSAIQNIFSRVTGSSISNIDGLIRANDANLFLLNP
NGIIFGPNASLDIGGSFLGTTANRIIFADNTQFSTTNPQTPSLLMVNVPVGLGFGSNQAA
IRVQGTGQRLIEDPLFPLLDRSSIVTGLRVSPGKTLALVGGDVTLDGALLTAEGGRIELG
SVGSGIVSLSPTTQGWALGYQNVQSFQNIQLLSQALVDASEATTGNGGGSIHLQGANVAL
TDGSFILIQSQGDQPGGSINVNASESLEISGSSPDGLLPSRLVNQTVGAGQGGDIELSTQ
RLIIRDGGYVDNRTLGSGNGGEVRVNATESVQVSGASAFNPSLLSFLNSETYGSGRAGDL
SVSTGQLRVLDGGAIVSATFSTGSTGTVRLNATQSIEVAGAQTSRLVASTVGSASGNEGN
AESVIINTRKLVVRDGGRVDSSTLAYGNAGSIIVNASESVEVSGKAPGFVNPSLIISSAN
IVDPLTQAFFGLPPVPTGDSGNVTINTPHLSVTDGAQVTVRNDGTGKAGTLIINADSILL
DNQGGITASTNAGESAQEGSITLNVRDSLQMRHNSIISAEARGDQRGGNIIINAGAIAAV
PEENSDITASAPQGTGGRITINTQGIFGTQVRDQQTPESDIIAVGKTPEFNGIVQVNTPE
INVQDALNQLNTNFFSTEQAIASSCFARRNVEQGSFTSTGTGGLPTTPYDAQGGRYPVTQ
VQALPHPATPQTSSPAPKTPSTWKLGDPIQEAQGISVTPDGRILVGTHPQLAALKDPQRL
ICHPTQVEE
Download sequence
Identical sequences K9WDU5
gi|428310837|ref|YP_007121814.1| WP_015182557.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]