SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310889|ref|YP_007121866.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310889|ref|YP_007121866.1|
Domain Number 1 Region: 352-535
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.77e-53
Family Adenylyl and guanylyl cyclase catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 7-186
Classification Level Classification E-value
Superfamily CheY-like 6.83e-24
Family CheY-related 0.0044
Further Details:      
 
Domain Number 3 Region: 177-306
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.76e-22
Family Heme-binding PAS domain 0.035
Further Details:      
 
Weak hits

Sequence:  gi|428310889|ref|YP_007121866.1|
Domain Number - Region: 556-596
Classification Level Classification E-value
Superfamily TPR-like 0.00813
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310889|ref|YP_007121866.1|
Sequence length 613
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTTKQVIICVDDETTVLRSLRTELQEAIGDDYLIEIAEGGEEALELIAELVADGYEFPVI
ISDHLMPKMKGDELLKRVHLILPKTLKIMLTGQADLEAIGNAIKDAKLYRYIAKPWQTDD
LCLTVKEAVNSYSQDKKLAQQNAQLQEMNQSLAHMNIQLQEMNQTLAKFNREQSMLIDQL
HQKESRLLKAEQKYRQIFENALEGIFQITPDGRFLSANQATAQLYGYESPEELMTTITDI
NHQLYVDPHHRVEFLTLMQQYGAVSEFESQVYRKDGSIIWINENARAVFDFNSSLLYYQG
FVEDITERKKAEVDRLQFTKELFQLNQAFSRFVPRQFLQCLNKQSIADVQLGDQVHQEMS
VLFADIRDFTTLAETMTPQNIFKLINAYLSRMEPAIIENQGFIDKYMGDGIMALFSGDAD
DALKAGISMLHRLTEYNQHRAQSNYTPLRIGIGINTGPLMLGTVGGEHRMDSTVISDSVN
LASRLESLTKEYGVSLLITHHTFARLNHPGEYSIRFIEQVKVKGKSKAVAVFEAFDGDEP
TIRQGKLATLKVFESGLWLYYKRSFSEAAKMFEAVLTMNPYDTVAQIYLQRCQFQKTKVL
PLSPSIPNQEQRF
Download sequence
Identical sequences K9WDI4
WP_015182609.1.75295 gi|428310889|ref|YP_007121866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]