SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310891|ref|YP_007121868.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310891|ref|YP_007121868.1|
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-54
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 1913-2063
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.55e-41
Family Histidine kinase 0.00063
Further Details:      
 
Domain Number 3 Region: 1400-1573
Classification Level Classification E-value
Superfamily GAF domain-like 1.5e-29
Family GAF domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1564-1695
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000147
Family PYP-like 0.044
Further Details:      
 
Domain Number 5 Region: 306-323,363-614
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000102
Family G proteins 0.078
Further Details:      
 
Domain Number 6 Region: 1748-1789
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000133
Family Homodimeric domain of signal transducing histidine kinase 0.0039
Further Details:      
 
Domain Number 7 Region: 1274-1347
Classification Level Classification E-value
Superfamily TPR-like 0.0000675
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310891|ref|YP_007121868.1|
Sequence length 2069
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSNNFVTLTGYRILDKIYSGSRTQVYRGVRSHDQKPVVLKLLLSEYPTFKELVQFRNQYT
IAKNLDLSGIVKPLALENYRNGYALVMEDYGCVSLKQKMGNTEGMGRNADSLKEFLNIAI
QIVQTLEGLIHHRIIHKDIKPDNILIHPDNNQIKLIDFSIASLLPRESQEIQNPNVLEGT
LAYMSPEQTGRMNRGIDYRTDFYSLGVTFYELLTGQLPFQASDPIELVHCHIAKIPTPPI
ELISSIPQEVNDIVMKLMAKTAEERYQSAFGLRADLETCLQRYSENCSIQTFRLGEKDIC
DRFAIPEKLYGREAEVATLLAAFDRVSGKGEMSNEIFGLISPLSSQFNIQNPTTEQSLKV
QKSQIELMLVAGFSGIGKTAVVNEVQKPIVRQRGYFIKGKFDQFKRDIPFSAWVQALQNL
MRQLLTESTTEVDTWKAKILDALGENGQVIVEVIPELELLIGKQPKVPELEGSAARKRFN
LLFRKFIRVFATQKHPLVIFLDDLQWADSASLKLMQLLMSEADTGYLLLIGAYRDNEVSA
AHPLMLTLDEIREADATVNQITLAPLDQPSLNRLIADTLSCSLERAAPLAELVLTKTKGN
PFFTNQFLKSLHEDGLITFNPPTSLSKGGENSLVLEGSTGGWQCDIAQVRTLVLTDDVVE
FMALQLQKLPINTQRVLQLAACIGNQFDLATLATVHEKSQTETAADLWRALQEGLIIPIT
EVYKFFQDTESIKVAQSQELFVSYRFLHDRVQQAAYFLIPEQDKPSTHLKIGRLLFSKGK
HGGSAPTVENWEEKYFDIVNQLNRGVGLIDERTERDQLAQLNLTAGHKAKASTAYAAAIR
YLNVGMELLEAQGWQRQYELTLALHNEAAEAAYLSGDFEEMERLAEIVRNSATTLVDKVK
TYEVNIQANIAQNKILEAVNIALQVLKLLGVEFPQKPSQLDIQCGLEEITSNLASQQISD
LIDLPKMTDPTTFAAMRLLSSIFSASFIAVPELMPLIVFKQVILSAQYGNTSLSAFAYVN
YGLILCGIVGDIETGYQFGQLALRLLDKLQAKELKTKILTVFHATVGIWKEHVRESLPAF
RAAYSNGLETGDLEFASNCAYLYSFHSSFAGKQLASLEPEMAAYSEVLAQLKQETYLNYN
KIYRQAVLNLIKKAEDPCRLMGESYNEETMLPIHQQANDRYAICNLSVNKLRLCCLFDNS
RLAIETAILAEQYLDGATATLLIPLFYFYDSLTRLAVFPDSPQTEQQSLLEKVTTNQEKM
QKWADHAPMNYLHKFYLVEAERHRVLGQWIEAMDCYDKAIQGANENEYIQEEALAYELAA
KFYLAWGKNIIAQTYLTNAYYAYARWGAKAKVEDLEQRYPQLLASLLNQKINCQVDDTIT
QLTTGTITSTSRGGSDVLDLATVMKASQTLSGEIQIEQLLSTLMQVVMENAGAEKGTLIL
LEGDSLAIAAQTVIGQVCNLQSIPVFGSQDIPVSLINYVWRTQEILVIHDATVPQHFAAD
PYIIQQKPKSVLCSPIKNQGKLIGILYLENNLTPGAFTPKRLEVLNLLSSQAAISIKNAK
LYAEVVEREKELGESEKRLAQFLEAMPVGVAVHDATGKLYYTNQTGQQLLGKCVVKEATA
EQLTNIYQVYRAGTDQLYPTDRLPIVRALKGERVTLDDLEIRRGETVIPLEVETTPVFDE
QGNIIYAIATMQDISDRKQAEADRLRLAQEREAKNVALQMNQEIEAKNQELAAALEQLKT
TQQQLIESEKMAALGQLVAGIAHEINTPLGAIRSSAGNIYKFLGQTLEQLPTLFQSLTPE
EGQDFLTLLQRSLQQESTFSTKEERQFKRALRRQLEEAAIENADVIADRLVIMGISQDIE
PFLPLLRKPDSSQILALAYKLSELKRGTMTINTATERASKVVFALKTYARYDQTGEMTPA
NLTEGIETVLTLYHNQLKKGVEVVRNYGNLPTMLCYPDELNQVWTNLIHNALQAMDYQGI
LTLSVMVDEQQAKISIGDTGKGIPEEIQAKIFEPFFTTKPAGEGSGLGLDIVKKIIEKHD
GKIMVESEPGCTTFKVFLPIHPIQEAANG
Download sequence
Identical sequences K9WG07
WP_015182611.1.75295 gi|428310891|ref|YP_007121868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]