SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310914|ref|YP_007121891.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310914|ref|YP_007121891.1|
Domain Number 1 Region: 303-483
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.48e-52
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 215-265
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000575
Family HAMP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310914|ref|YP_007121891.1|
Sequence length 485
Comment family 3 adenylate cyclase [Microcoleus sp. PCC 7113]
Sequence
MKLHVFHSIRRQIMAATTFLILVIVTAVVWSWAKNESEVYRFSERQGAQTLAVSLSNAWT
NELVDQNWSQIRLGLNLMLRRNPEFIYILVSDTRLSNQIVAAAPDDFMEQYIPDIVPVED
TKSAWKVYDGTRLVEPYLLRNVEFPKGEMRARRGEQVIEVASDIRNATGERIGTLRIGIS
LRQVNRAVREAINKALMVGAMGWAFGLAGAYILARQLSHPVQRLQISATKIAAGDLQHRA
DINRADELGALAEAFNDMATALQKSFNRLQKTLESFERFVPEKFLKVIASDGIENIQVGV
ASTRKITILFADIRGYTSMSEQMTPLETFALLNEYLALMGQVINDAGGFIDKYIGDAIMA
LFEDETTGSALRAAVAMQQVLEAFNEQRLPQKQPTIKIGIGIHRGEVVLGTIGFTSRIES
TVIGDAVNVAARVEGLTRKYDCCILVTESVVVALQHPEVFNLRLVDDSVKVKGKNEPVAI
YELVV
Download sequence
Identical sequences K9WDL2
gi|428310914|ref|YP_007121891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]