SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310947|ref|YP_007121924.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310947|ref|YP_007121924.1|
Domain Number 1 Region: 392-572
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-42
Family Histidine kinase 0.00056
Further Details:      
 
Domain Number 2 Region: 596-719
Classification Level Classification E-value
Superfamily CheY-like 6.55e-29
Family CheY-related 0.0015
Further Details:      
 
Domain Number 3 Region: 320-404
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.86e-23
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 4 Region: 5-143
Classification Level Classification E-value
Superfamily CheY-like 3.56e-22
Family CheY-related 0.0026
Further Details:      
 
Domain Number 5 Region: 256-323
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000244
Family Heme-binding PAS domain 0.053
Further Details:      
 
Domain Number 6 Region: 142-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000164
Family Heme-binding PAS domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310947|ref|YP_007121924.1|
Sequence length 719
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPTETLTILLVEDNPQDACLVQEMLQAAKTFPFQLIQVSRLEEALTCLSRSSSISVILLD
WSLPDAQGAGMITQLRRVSLDTPILVINDWEDEAIALQALQTGAQDYLVKHQTDSKRLVR
SIRHAIAREKANLSKRCVSHIRTQQEQSLRESEAKFRTLYESTSTAVILLDEKGIFDGNS
AALRLFGCTHREQLCGEGEPMESGRVGESIHRQGREEVGNFPCSQSRYHPVVASSLLKSC
VPLIGFSPAVQPNGEDSYSLANEYITKAIAQGSCRFDWMYCKQNGEEFPAEVTLTRIELG
KRKILQATIYDISDRKATERQLLQAKEAAEAGSRAKSEFLAMMSHELRTPLNAVLGLSQL
MRQEIFGTLNEKQKEYVSCIQSSGEHLLALINDILDLSKVEAGKEQLTFVPLDIQDLCDY
CLAMVREQAHEQGLKLKLQIDPQARILIADERRCKQMLLNLLSNAVKFTPMGEVLLSVTK
RPISSSVSGIAESTSVQEICFTVKDTGIGIASHHLPLLFEPFRQLDSGLNRQFTGTGLGL
ALTRSLARLHGGEVIVQSNLGEGSQFTLCLPDRLLEECILPSLPQDPGVIQGQSCPLWAK
SRILLVETDERSALILKDYLQVIGHRVEHLIDGQDFLHKVRQFKPSLILMDVQLRGEYTG
FDLLAALRREPDTKNLKVVMVTAMAMAGDRERCLEAGANEYLSKPIGIAQLEAILMRFL
Download sequence
Identical sequences K9WE60
gi|428310947|ref|YP_007121924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]