SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310998|ref|YP_007121975.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310998|ref|YP_007121975.1|
Domain Number 1 Region: 1603-1772
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-47
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 1792-1914
Classification Level Classification E-value
Superfamily CheY-like 1.71e-34
Family CheY-related 0.0049
Further Details:      
 
Domain Number 3 Region: 671-797
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-29
Family Flavin-binding PAS domain 0.023
Further Details:      
 
Domain Number 4 Region: 1046-1173
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.058
Further Details:      
 
Domain Number 5 Region: 118-237
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.88e-26
Family Heme-binding PAS domain 0.031
Further Details:      
 
Domain Number 6 Region: 1197-1360
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-22
Family GAF domain 0.0098
Further Details:      
 
Domain Number 7 Region: 1369-1549
Classification Level Classification E-value
Superfamily GAF domain-like 4.91e-20
Family GAF domain 0.01
Further Details:      
 
Domain Number 8 Region: 263-416
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-20
Family GAF domain 0.026
Further Details:      
 
Domain Number 9 Region: 919-1047
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.12e-19
Family Flavin-binding PAS domain 0.078
Further Details:      
 
Domain Number 10 Region: 406-529
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.19e-18
Family Flavin-binding PAS domain 0.071
Further Details:      
 
Domain Number 11 Region: 797-920
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000593
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.051
Further Details:      
 
Domain Number 12 Region: 1539-1610
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000165
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Domain Number 13 Region: 569-682
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000122
Family Flavin-binding PAS domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310998|ref|YP_007121975.1|
Sequence length 1916
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLKVIRSQPRAYVIAFLAWAIALGLTWVLEPLMSPTIFALFYPAVMVSSLYGGLPSGLLS
ILLAALATKYFFLPPLYSLAFTSASNLFRFTVLLLVALMISLVSTELLRAKQRMELSLSR
LRRSEEQYRLIVETTNEGVWLVDEQARTTYVNAQMARLLGYSIQDMLGRSAFDYIYEKDR
AEAERLMERRRQGISEELEFCLRCQDGSPIWVNCNVNSMLSDNGKCFAMLAMVTDVTERK
RTEKRQRVQYAVTRILAEATTLADALPTILQSLCESLGWQVGMIWSLDRQGNLLRFVESW
HTPTINVEEFTQINQQATFAPGIGLPGRIWASGQPAWISHLVEDNNFPRVELAAKAGLQG
ALGFPIRLDHEIVGVIECFSDTVQEPDQDLLQMMMSIGSQMGQFMERKRSEEALAENQAL
FLSFMNNIPGTAFIKDEQGRYLYTNPVAEKLVNCPPQALVGKTDFDILPTEVAQQVREND
RAVLAADEPKEIVEALPQEDGIHYWMSLRFPFKDGSGKQRLAGMSFDISDRQRAEDQIGT
LNKDLNRRVNELQTLLDVIPMGIGIALKPDCRDIRMNPAFAEWLKLPSYTNGSTSQPNAE
QLPYRVYRQGQELPPQEQPIQYAAAHGVIVRNVEIEIVHDDGRVLHLLANAAPLLDEEGQ
VRGCVGAFLDISERKQAEESLRASENLYRTLSEAVPDFIWSCNAQGQLDFVNSRWLEYAG
MTVEDMNTGGFEQVYHPEDLSGAMEQWNQAIYQGEPFETESRFRGKDGVYRWFMVRAVPL
KDAQGNILKWIGVTTDIHERKQTEEALSQSEERLRVALKHSPISVFNQDRELRYTWKYGS
DFEDEVEDILGKRDIDLLTGADAEILTQIKRQVLETGMGTRQEVKISLHGQDWYYDLTVE
PLRDAKNQIIGITCAAIDISERKQAQMKLQKSETVLHAFLASSPVGLAFLDRDLRYIHAN
QALAAINGIPLSEHLGRTLGDVLPQWAPQLAPILHRVMQTQEPLLNQEISGELNQPGVHR
HCLVSYYPVCLPDGQVLGVGVTSMDVTQSKRVEQALRESESLFRRMADGAPVFIWMSGLD
GHCTYFNQPWLDFVGQTLEEAVTLGWPDGIHPDDTEYCLETYLSAFNARQRFQIEYRHRR
QDGEYRWLLDEGVPLFNEEGRFAGYIGSGIDITERRQTEKAQHYLAEASRVLSSSLDYQT
TLASIAQLTVPELADWCTVHLIAEDGSLQPLVTAHVNPAKIAWANQNNQKYPVDPNDVRG
VAQVLRTGQSEFYPDIPDHLLVEAARDQEHLQILREVGFKSVMIVPLLTRGRTVGTISFV
AAESGRQYDSTDLALAEELARRAALAVENARLYQQAQQARQTAEQAADVTARLQSITAAF
SEALTLDQVAEVVVNQGIAALGVSAGFVALLTDNDTSLEIVKSVGLPEHVIEDWKSFSIT
APVPMAELARTGQPIFLENIAACPTQYPIVACVAKSTGYQAFACIPLTVEGRTLGGMSFS
FACATSFSPEDRAFMLTLGHLCGQAIARARLYEAEQRARTEAEAANRIKDEFLAILSHEL
RSPLNPILGWTRLLRSRKFDEKATDRALEIIERNAKLQTQLIEDLLDVSRILRGKLVLNE
SPVNLVSTIEAALETVRLAAQTKEIQIQTVFEANAGQVSGDANRLQQVIWNLLSNAIKFT
PSGGRVEVRVEQVGSQVQIHVQDTGKGISPEFLPYVFEYFRQENSSTTRQFGGLGLGLAI
VRYLTELHGGSVHAESLGEGLGSTFTVTLPLMGTQAEVIPEPMPSRGAADLDGLRILMVD
DETDIRELVAFILQQSGAEVTVAASAEEALAALNQSVPDVLLSDIGMPDLDGYMLMRQVR
TFSAQQGGQIPAIALTAYAGEYNQQQALQAGFQLHISKPVEPEELVRAIARLVGRG
Download sequence
Identical sequences K9WFN6
gi|428310998|ref|YP_007121975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]