SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310999|ref|YP_007121976.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310999|ref|YP_007121976.1|
Domain Number 1 Region: 310-630
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.23e-22
Family Galacturonase 0.027
Further Details:      
 
Weak hits

Sequence:  gi|428310999|ref|YP_007121976.1|
Domain Number - Region: 895-1105
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000202
Family Galacturonase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310999|ref|YP_007121976.1|
Sequence length 1141
Comment hypothetical protein Mic7113_2786 [Microcoleus sp. PCC 7113]
Sequence
MLSQTLTSPVVAQTSDTETTTPLPSSSGQAADLKIRPRVGAGFTTTGAGYQEPFFSLEGF
FPIQQNPGNNLTFLEGKVLFFTDSNIGTNLILGKRFYSSDQNKILGGYLSYDVRDTGNTL
FHQIGGGFERLSDAWDLRINGYLPIGNTREKMAESISNPFFQQNFLLLNRTTQFEAAMAG
VDVEAGGRLLRLGDGDLRGYAGVYYYSAQGSDSGFGVRGRLEARPTDTLRLGLSIQHDPT
FDTKVVLSLGVNVPGTRPRGVDKSSVLARLGESVERKAAITVDEQAKNDTVVATNPKTGA
PFVFRHVTLGTGAGDGTFENPSGTVQDGLNLAQSGEIVYVQAGTNPGIEAFKIPDGVSVL
STAVAQRIDTVGFSTLQLPLSGSGGFPVVNGTVTLGNNTTLSGFAITNATGSAIQGISIQ
NVTVRDNRITNPSEQGINLTDVAGTSLIANNTVTGSRLGGIFVSASGNTQQELNVNSNTI
SDSGRQGIFVQASENAQQKFTANSNTVSNSVGQGIFLQTNNNSRQNVAIANSTISRTTVD
SQGEGGQGLFAQANSGAQQTVKLENTQVSDSANQGIFVSAFSKVDEPQSRQNVTLTGTSV
SNSISQGIFLQGNNNSRQDVAIANGTINGTTRDSKGEGGQGLFAQANSGAQQTVQLDSTK
VSESAGQGIFVSAFSKVDEPQSRQTVTLNGTSVSNSTGQGVFLQANNNSQQQFAIANGTI
NGTTRDSKGEGGQGLFAQANSGAQQQITVDNSQVSNSAGQGVFFSTSSQASEPQSRQNIT
LNGTNVSNSAGQAVFLQANNNSQQIVAIANGTIKSTALDSKGEGGQGLFAQTNGGAQQQL
TVNSTQVSDSAGQGMFFSTSSTAEEPTSQQTVNLNGNSVTNSKGQGVFFQANGNSTQQFA
ITNSTQQFAITNSTINGTTVDSKGNGGQGIFTQANGGAQQNFNIEGTQVSNSAGQGIFVS
ASSQLTEPTTRQTFIINNTSVNNSAGQGIFVQASNNSTQQVAITNSTINGTTVDSQGQGG
QGIFTQANGIAQQNININKNTVSNSAGQGIFMQANSDSQVSADVQFNILQNNMIPGFYAV
MNATKTFCVRLNGNNSNTNFVLQRNAGTFQVSDRDSVSTNNTGTVDFAPAIESFTNVTTC
P
Download sequence
Identical sequences K9WDY0
WP_015182719.1.75295 gi|428310999|ref|YP_007121976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]