SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311023|ref|YP_007122000.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311023|ref|YP_007122000.1|
Domain Number 1 Region: 347-543
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.3e-52
Family Ppx associated domain 0.001
Further Details:      
 
Domain Number 2 Region: 151-333
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.48e-43
Family Ppx/GppA phosphatase 0.00085
Further Details:      
 
Domain Number 3 Region: 24-147
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.6e-36
Family Ppx/GppA phosphatase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311023|ref|YP_007122000.1|
Sequence length 550
Comment exopolyphosphatase [Microcoleus sp. PCC 7113]
Sequence
MVDSLTKESSITDCTPNLDQNCILAAIDIGTNSIHMVVVEIEPTLPSFTIIAREKETVRL
GDRHPKTGELTPEAMERSLGALQRCQDLAKSCNAEQIVAVATSAVREAPNGRAFLKQIQS
DLGLFVNLISGPEEARRIYLGVLSGMEFNNQPHAIIDIGGGSTELILGDSHEPRYLSSTK
IGAVRLTAEFITTDPISLGEFQYLQAYIRGMLERPVEELLSHRQPGEELRLVGTSGTIET
LATLHAREKLGTVPNTLNGYQMSRKDLKEMVKRLASMSCAERGAISGMSDRRSEIIVAGA
IILVEAMTMLGVECLMIGERALREGMIVDWMLSHGLIEDRLRYQGSVRERSVLKIAQKYQ
VNSEYSQRVANLVLSLFNQTKGHLHDWDCEERELLWAAAILHNCGLYVNHSAHHKHSYYL
IRHAELLGFLETEIEIIANLARYHRRSTPKKKHENYSNLSSKKHRQLVCQLSALLRLAVA
LDRRQIGAIARVQCEYRPHEKELHLRLFPAQPEDDCALELWSLNYKKGVFEEEFGVKLVA
TLESAPVTVS
Download sequence
Identical sequences K9WFR1
gi|428311023|ref|YP_007122000.1| WP_015182743.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]