SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311029|ref|YP_007122006.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311029|ref|YP_007122006.1|
Domain Number 1 Region: 418-624
Classification Level Classification E-value
Superfamily GAF domain-like 8.29e-53
Family GAF domain 0.001
Further Details:      
 
Domain Number 2 Region: 757-849,879-950
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.94e-38
Family Histidine kinase 0.0026
Further Details:      
 
Domain Number 3 Region: 151-280
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.93e-23
Family Flavin-binding PAS domain 0.054
Further Details:      
 
Domain Number 4 Region: 279-408
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-19
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.062
Further Details:      
 
Domain Number 5 Region: 664-704,734-766
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000432
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311029|ref|YP_007122006.1|
Sequence length 979
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MVLAEFFIPHGHCYLWKSELVSLHIVSDALTAVAYYSIPLTLSYFVLKRQDVPFNWIFLL
FGAFIVSCGTTHIMEIWTLWHPDYWLSGWIKAFAAVVSLYTAFELVSLLPQALAMPSAAQ
FEAVKSEIKERLRAEAELQQAIVKLKQEMAERQQAEKALRESEERLQLALEGSALGWWDW
NITTGQTYFDSSWKRMLGYEVEEIDNNYESWKQLMHPQDKPRVMEVLHAYLRETLPLYEV
EFRMRSKSGQWKWILIHGKVFERDESGAPVRMLGTQKDISDRKLAQERLRHSEANLATAQ
KIAHIGNWEFDVVSGEITWSEEKFRILGLDPTQPEPQYAELLEKIHPDDRKLFQQATSQA
LAFGTGYELDYRVVRPDGQVRYIEGRGEAVVNEQGQVIRLFGTALDITDRKRVEEALQES
VQRERAIARAIQRMRQTLDIEAIFSATTEELRQLMNCDRVLIYRFNPDWSGEIVSESVGS
EWISLLQEQVHHPHLAQKTLEDDRCAVKKFDSAAGRESVLSHACPVQDTYLQETQGGAYS
QGASYAVVQDIYQAGFHDCYINLLEQFQARAYIIVPIFCGSKLWGLLATYQNSGSRQWKT
TETNVVVEIGNQLGVALQQAELLAKVQKQSEALQQSTQRERDKATQLKLTLEELRHTQSQ
LIQTEKMSSLGQMVAGVAHEINNPVCFILGNLAPAKEYFQDALRLIQLYQETYPNPTPAI
QELAYEIDLQFLREDWSKLMHSMQVGAERIEAIVRSLKTFSRLNESELKPVDIHEGIDNT
LLILQSRLRAEGDRPEIKVIKDYGSLPKVTCYASQLNQVFMNLIDNAIDALENQPSPRVI
TIHTSLMGGDSGTRKGGNLTHPLRKNSPNSQALSSNNQWVMIRITDNGSGMHKEVQQKIF
DPFFTTKSVGKGTGLGLSISHQIIVEKHQGQLKCLSVPGKGTELIVEIPVSGQTGTTHNR
FPLQESNYKDRYCLTVFED
Download sequence
Identical sequences K9WE05
WP_015182749.1.75295 gi|428311029|ref|YP_007122006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]