SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311040|ref|YP_007122017.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311040|ref|YP_007122017.1|
Domain Number 1 Region: 992-1179
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-48
Family GAF domain 0.0003
Further Details:      
 
Domain Number 2 Region: 1276-1458
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-40
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 3 Region: 1485-1629
Classification Level Classification E-value
Superfamily CheY-like 2.56e-35
Family CheY-related 0.0068
Further Details:      
 
Domain Number 4 Region: 714-825
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-29
Family Heme-binding PAS domain 0.033
Further Details:      
 
Domain Number 5 Region: 878-992
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.28e-28
Family Heme-binding PAS domain 0.00091
Further Details:      
 
Domain Number 6 Region: 532-660
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-26
Family Flavin-binding PAS domain 0.068
Further Details:      
 
Domain Number 7 Region: 404-533
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-24
Family Heme-binding PAS domain 0.062
Further Details:      
 
Domain Number 8 Region: 152-285
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-23
Family Flavin-binding PAS domain 0.051
Further Details:      
 
Domain Number 9 Region: 1202-1288
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.49e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 10 Region: 300-405
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Heme-binding PAS domain 0.052
Further Details:      
 
Domain Number 11 Region: 12-115
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000681
Family Heme-binding PAS domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311040|ref|YP_007122017.1|
Sequence length 1712
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MDAEQKSDALHELILSHISDAVFITDSNGTFTFVCSNANVIFGYSRQEIQQFGNIRHLLG
ENLFEMHQLESCGELRNIQQEITDKLGKSHHLLVNIKRVSIQEGAVLYTCRDITEHQQAK
ARISFLNAQLEEQVSDRTAELHQIYAQFTQEIQERQRVEDALRESEAQFRQLAEKIESVF
WMVKPDLSELLYVSPMYEQIWGRSCESFYQNPYSWFETMHPEDRERIRANAEQAALSDYH
QAELEIEYRIVRPDGSIRWIRARAFPIRDDAGTVYRVAGISDDITERKQAEIDRDRQTAQ
RQQVELQLKESELRLNTIVNSTSDGILIIDKQGIVRFANPSAAKLFGRTLEHLMNYDFGE
PVLVGDVAELSIIRSGGEIGIGEMSVAQTEWQGNPVYIVSLRDITERRQAEEALRESEER
FRQLADNIETVFWLFNPYTEELLYISPAYETLWGRTCESAYATASNWVNTLYPEDREIAS
ASFAQQLQGHSTHVEYRIIRPDGQIRWILARTFPIKNERHEVYRIAGIAEDITDRKQAQE
ALRQSEERFRAIFENAGIGIAVVGTDLKLVQTNPFFQQFIGYNSQELASLDYTDITYIED
SLIEQALAQECMAGIRNGYCIEKRFIRKDGEIIWGNLTVSIIWDTAGQFQFAVGLIEDIT
ERKQVEAQLQQYRDRLEELVEQRTAQLQQEIIERQRAESAIHFQARLLDVVEHAIIATDL
SGVIIYWNRFAEQLYGWSATEAIGCNILEITPSEASQEQATEIMSCLSRGESWSGEFWVQ
RRDGTLFPALVTDSPIYDETGSLIGLVGISFDLTERKQAEEALQKANAELGIRVEERTRD
LGSAIERLQQEIVRRKQVEDALRASQARFAGILEIANDAIISIDAHQQITLFNQGAEKIF
GYTPQEVLGQPVSLLMPTRYADTHRQDVVNFAQSAGEARRMRNRREIWGRRKDGSEFPAE
ASISMLAMGGEKIFTAILRDISERKQAEEALQLQMNRERLLAQISQHIRQSLNLDQILNT
TVHEVRQLLQSDRALIFRIELDKIGIVTHESVSPGWNSTVGNEYKYEEFPVDCYQSYCQG
KARIITDITLDETASCLMKDMQELGVKSRLAVPILHSHAGLEARQNLALNMQNSPLWGLL
IIHQCSHIRSWQSWEVNLLQQLATQVAIAIQQAELYRQLELELNERKQAQAQLQQAKEAA
VSAAAQSAAANQAKSEFLANMSHELRTPLNTILGFTQLMSHERTSLGHETHSLSPQQQEY
LGIINRSGEHLLALINDILSMSKIEAGRLTLDENSFDLYRLLDTLEKMFQLKAINQHLKL
IFERTVDVPQYIHTDESKLRQVLINLLGNAIKFTPSGQVMLRVVRELQAECWAVEPSNSS
PHLQPATLRFEVEDTGTGIAPEEIDSLFNPFVQTQTGRKSQSGTGLGLAISQRFVRMMGG
EITVSSVVGGGTIFKFDVRVSVAPSAQIFPQPLKAQVIALAPDQPRYRILVVEDQLTNRK
LLTNLLEPLGFEVREAQNGQEGVALWESWKPHLIWMDIRMPVMDGYEATQQIRARERQQA
AQGLNHLCGELSFSYWATVIIAITASAFEEERERFLTAGCDDFVLKPFRAEIIFEKISQH
LGVCYLYEHRDSTFSSQSVVPQPPLTPEALAVMPADWIVQLHQAARSLDAELMYKLIAQI
PESHHSLAIALTDLIDDFRFDRMMELTQPTAL
Download sequence
Identical sequences K9WFQ3
WP_015182760.1.75295 gi|428311040|ref|YP_007122017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]