SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311041|ref|YP_007122018.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311041|ref|YP_007122018.1|
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily CheY-like 9.39e-40
Family CheY-related 0.00042
Further Details:      
 
Domain Number 2 Region: 229-317,356-428
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.66e-36
Family Histidine kinase 0.00085
Further Details:      
 
Domain Number 3 Region: 154-238
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 8.24e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311041|ref|YP_007122018.1|
Sequence length 442
Comment bacteriophytochrome (light-regulated signal transduction histidine kinase) [Microcoleus sp. PCC 7113]
Sequence
MNELSADPSSKYILIVDDQPNNLRLLSTTLMDAGYKVKSAISSQMALIGLQTALPELILL
DIMMPDMNGYQLCQQLKANTPTKDIPVIFLSALDDEADKLKAFELGGVDYITKPFKTQEV
LARVKNQLTLVRQQQRINEQNLQLLQQNLRLEQLNIELVQANTELLRSNKDLEEFAYIAA
HDLRSPLQIIKAFTYLLSQKYQGVLDEKAELYITRIVEAGNRMERLIQDLLNYSRIGTKA
LEVEPLDCNQILQQVLTNLQTEIESSGAAITHEELPTVVGNATQLTQLFQNLICNAIKFR
RPEVPPQVKISLEYKDCRAGIAREVENSGSTDMGGEQNPLMMPAERQTCQYNRVGEWVFG
VHDNGIGIKPEDFERIFLVFQRLHTSEEYPGTGIGLAICKKIVERHGGHIWVESDPDLGT
SFYFTLSITLLHDSETPRASEK
Download sequence
Identical sequences K9WGJ1
WP_015182761.1.75295 gi|428311041|ref|YP_007122018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]