SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311102|ref|YP_007122079.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311102|ref|YP_007122079.1|
Domain Number 1 Region: 407-578
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-63
Family GAF domain 0.00016
Further Details:      
 
Domain Number 2 Region: 713-803,840-914
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.45e-39
Family Histidine kinase 0.0035
Further Details:      
 
Domain Number 3 Region: 37-145
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.94e-33
Family Flavin-binding PAS domain 0.0008
Further Details:      
 
Domain Number 4 Region: 142-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.93e-22
Family Heme-binding PAS domain 0.01
Further Details:      
 
Domain Number 5 Region: 272-397
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000148
Family Heme-binding PAS domain 0.063
Further Details:      
 
Domain Number 6 Region: 623-663
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000706
Family Homodimeric domain of signal transducing histidine kinase 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311102|ref|YP_007122079.1|
Sequence length 929
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKAMVAKKASCRVLDANQSEPVDIGNKRVYDRALAATSCGIVISDARCFDNPIIYCNPAF
LKITGYSQEEVIGRNCRFLQGHDTDPIAVEQIRQSIRTGQEVRVVLKNYRKDGTLFWNDL
TISPVRDSSGKVTHFIGVQTDITERKQAEETQQLMQFSIDRAADAVFYIRPDGTLFYVNE
TASKALKYSREELLRLSIQDIDPNFSLSVWQSHWQQVREGGSFSIETQHRAKDGQVFPVE
VTFNYLRFNNQEYNCAFARDISEAYRQAQASKQAQKALQRSNALLKAQQESDPNGVLVTD
ETGATLSYNQRFCEMWQIPEGMRQLGEHKIIFNWLLPLIQEPQRVFSQMEYLEENPSLIS
REEIHLTNGRVFDCYSAPARSPEGESYGRIWSFQDITEQKQTETRLRQQAERERLVSGIN
QRIRQSLNLDEVLNTAVEEVRQFLACDRTLICRFNLDWSGTIVVESVGEEWTPASAINIQ
DTCFQESKAHLYQKGRIRAINDIYNTDLSPCHIQLLERFQVRANLVVPILQGDKLWGLLI
AHQCSKTRDWQDSTIELLRQISVQLSVAIQQAALFKQLAEELAERKAAEAALRRSKQALK
TQATELKKALNDLKQAQLQLIQTEKMSGLGQLVAGVAHEINNPVTFISGNITHAEMYAQD
LLELVELYTENYPQPVPAIAKQIEVIDFDFLKKDFPKLLKSMEIGAYRIRQIVLSLKNFS
RVDEAERKLVDIHEGIENTLLILQHRLKPEAGNIQLVKEYGNLPFVECYPGQLNQVFMNL
LNNAIDALEKSVPVVTTEHHTTQATTPSQPKTKIIKISTEVADCSPSQTSNSDEIGTPQN
VIIRIADNGSGIPKDVKKRIFDPFFTTKPVGEGTGLGLSISYQIIVEKHGGQLECLSVPG
EGTEFIVQIPLAPSKIKTLQTTTLPSGEG
Download sequence
Identical sequences K9WEP7
WP_015182822.1.75295 gi|428311102|ref|YP_007122079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]