SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311137|ref|YP_007122114.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311137|ref|YP_007122114.1|
Domain Number 1 Region: 544-691
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.2e-36
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 181-307
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.56e-25
Family Flavin-binding PAS domain 0.022
Further Details:      
 
Domain Number 3 Region: 50-166
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.7e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.036
Further Details:      
 
Domain Number 4 Region: 459-539
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.87e-16
Family Homodimeric domain of signal transducing histidine kinase 0.003
Further Details:      
 
Domain Number 5 Region: 305-438
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000244
Family Heme-binding PAS domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311137|ref|YP_007122114.1|
Sequence length 697
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MCETELTIAPQNSNWATRVCTQAQAKETMQNIEESPPTSLLLHPESYVDLVQGLDVIIWE
MDALTWKFTFVSDRAQDILGYPISQWFDQPQFWQDQLLHPEDREWCIHFCVTATQAAKDH
QFEYRAIAADGRVVWLKDLVRVVCDENGCAKRLRGVMVDITQEKEAQQRTQQLLREREER
SELERVQKALRQSEERYRSLVEATSPIIWDTNAEGELVTEQARWSAFTGQTYAEYQGWGW
LNAIHPADRTHTAQAWREALANRTLYQVEHRVRRNDGEYRYMSARAVPVLEPDGSIREWV
GVHTDITQRKQVEAARDSALCEAQAARAALQWVFMQAPAAIQVTRGSNHITETANSLYIK
LTGKRDLVGKPVREAFSELEGQGFFELLDQVYATGEPFIGKEMPAVFDRNDDGKLEESFW
NFVYQPLVDGEGNVYGIMTHAVEVTEQVQARQEIEKKAEELAELTRSLERSNQELDQFAY
ITSHDLKAPLRAISTLSEWIEEDLGDQIQDDSREHLRLLRGRVQRMTDLIDGILQYSRAG
RVQQVERVDVAVLIAEVMELIAPSPDILMVVEPGMPTLKTEKIPLEQVLINLIGNAIKYA
QCPHARIQVSVRDVGRYYEFAIADNGPGIAPEYHEKIWVIFQRLEARDKVEGTGIGLSVV
KKIVESRGGQVWVESELGAGATFRFTWPKYFQKRVKA
Download sequence
Identical sequences K9WES6
WP_015182857.1.75295 gi|428311137|ref|YP_007122114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]