SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311153|ref|YP_007122130.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311153|ref|YP_007122130.1|
Domain Number 1 Region: 698-792,822-893
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.2e-40
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 920-1047
Classification Level Classification E-value
Superfamily CheY-like 1.02e-34
Family CheY-related 0.0061
Further Details:      
 
Domain Number 3 Region: 629-710
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.08e-24
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 4 Region: 495-621
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-23
Family Flavin-binding PAS domain 0.067
Further Details:      
 
Domain Number 5 Region: 5-135
Classification Level Classification E-value
Superfamily CheY-like 3.42e-22
Family CheY-related 0.0016
Further Details:      
 
Domain Number 6 Region: 169-296
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000019
Family PYP-like 0.094
Further Details:      
 
Domain Number 7 Region: 344-430,459-496
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000176
Family Heme-binding PAS domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|428311153|ref|YP_007122130.1|
Domain Number - Region: 290-328
Classification Level Classification E-value
Superfamily Calcyclin-binding protein-like 0.0785
Family Siah interacting protein N terminal domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311153|ref|YP_007122130.1|
Sequence length 1152
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQCKNNPILIIGNRIENRQVFVQYLSQSKYDITQASNGEEALKIIENGLKPSLILLDMPH
RGGSKVTQKIRKIWQAEQVPILWLIDKNQNQNWETGLEMGVNDYLTQPLSKEELIFRINT
QIELCRLKAENQRLSREGKALKQENTDLKILLETSTEHGDTVVNQLKDQADEAVRESERK
LAQFLEAVPVGVGVLDANSKLYFLNQKAKEIFAKGVDPDTPVDRLSEAYQIYIAGTNELY
PSENLPIVRSLKGENVTADDLEVHQGNQRIPIEVWATPIYDADGNIAYSINALQDIAERK
RTEKILADYNRNLEQEVADRTQELEEKNRQLQQEIRASEIAARQRQLLEDKLRTSEKRMR
AVFEAMTDIILVIDSQGTNIEVAPTNPGRLYEGTTYLVNQTIEQFIQGERAENWLSQIRR
VIETQETIDFDYSLPINKDEVGSFKSVGNTTQERGEPADHSLQTLSFTLHPSEVWFTASL
SPLPDGSVLWVARNITARKRAEMALRQSEEKFAKAFRSCPSAFTITRQIDGCHIEINDSF
CQFIGYTRAEVLGRTAVDLNLWVNWEDRTQLFQILQEEGVIRNYEFTFRTKSGEVRTALL
SAEMIDLDGQIHIISVSQDISDRKQAQAALQQAKEAAETANRAKSRFLANMSHELRTPLN
AIIGFTQLLTRDSSLNPEQQEYLGIIQRSGEHLLELINNVLQMSKIEVGRVTLNKNNFDL
YHLLDTLEAMFKLPVQNKNLQLVFDRTPTLPQYVQTDESKLRQVLINLLGNAIKFTTEGG
VTLRIASKFKSEESNNLPVKRLNVEGSQPSSYQQHLKLQPVTLYFEVEDTGFGIAPEEMD
SLFEPFLQTQTGRQALEGTGLGLPIARQFVQLMGGDIRVSSHLGKGSIFHFEIEVDIAQE
PKIVTTQASRRVIGLESGQPKYRILVVDDRLESRVLLVKLLASVGFEVLEAVNGQEAIEL
WSSWEPHLIWMDMRMPVMDGYEATKRIKADLKGQATAIVALTASAFEEERSVVLSAGCDD
FVRKPFRESVIFEKMTQHLGVRYIYAESASSASEGGRQKMESEPGDSSYPADSAVPYILE
PSSFYVMPIEWVQELYQAAVTIDNERILQLIEQIPAAHNPLAKVIADLVNNFRCDKILDL
IEQAKILEQGTD
Download sequence
Identical sequences K9WG28
gi|428311153|ref|YP_007122130.1| WP_015182873.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]