SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311162|ref|YP_007122139.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311162|ref|YP_007122139.1|
Domain Number 1 Region: 1670-1854
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-40
Family Histidine kinase 0.0000147
Further Details:      
 
Domain Number 2 Region: 2034-2154
Classification Level Classification E-value
Superfamily CheY-like 6.97e-33
Family CheY-related 0.00093
Further Details:      
 
Domain Number 3 Region: 7-128
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.01e-29
Family Chemotaxis protein CheA P1 domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1855-1997
Classification Level Classification E-value
Superfamily CheW-like 2.88e-24
Family CheW-like 0.0015
Further Details:      
 
Domain Number 5 Region: 1515-1570
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000239
Family Homodimeric domain of signal transducing histidine kinase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311162|ref|YP_007122139.1|
Sequence length 2161
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MQSEQQQRIMGYFIEEAKDHLNTIEQGLLSLQSTMEDREMLNEIFRAAHSVKGGAAMLGI
NSIQQTAHRLEDCFKTLQESSVKPDNQLESLFLRVFDTLQALVEQLQSPFGLSDDTAGEI
MSDAEPVFEELHTHLETLVQTASDSPAVMVEAPKVTLANSQMNTANPKPLPANFKRDVLI
ELREMLQLFKQQDLPEHREALQAHCLNLVRLGEPQDLPGWDELLETARVAIACSANSYRL
LANIVIKEIKQAQELVIAGRSVEICASEQLNALVPESHASEIPVELQSQESEFDRSFDQD
FAPDAQESETLESHSQTFQDESESSLTHLFDGSDTEIQSDLQDYIPETLVEGDSASSPAF
IQSEQQKTRRIYRFAAPSEPEVGVAELNTLADIFEGQMPDLDETWQDEEVINLDDNSTAS
YSGNSFSLDEQSDFSDLVSDLDSLNLSDDASTSEDLMDLFGDESLEEVVPHTPESSDSNW
RGLDAETPLSTTDSGMDDFSDLLFEEDSPDPVFASSRESEDLSNLFGDSFFEENSLLEQD
LDDFDLEADPTSQLQHPDDDLFAMPMADVFASEPEEFSNETEALIRESFPTQDNEFFDWE
DSSQPLENLEDEAIGLDSVAPTQSDMDFGELTEISANVGGERPHTASPASGTAPDPELSD
EPVIDNQATVLGWEELDESTADFDFDTQADFNQGKEVGDLTPVESLQFDDFGLDADTADL
FQPSDLSLDDSFFDTSTSDIPAQERESFSDLALENFMSTDELSGVDDWNWDEENEIPLDE
AATFELGGDLTDPTTTDLMPESLGQSESEADDDLSSWQDSATEESFWDVNQPESTSNEFE
LAGRDAEGDASALDFDFEETSSDAFNFEVNNIGDRDDLLEDEALSTSMAAQSAALQALEA
FEDLLETPTQEAATQASEGLEFSDLDQIEAHSELDDLNGFLNAEDVSEADARSPINDDDD
GSFWEETHEPSDSQVEQPLNFEDFSLFDIPEASDNAGVASLQESALPEETFEDLLFESSA
SEEDQSAELSDAFFDTPENDLFDLEFTEASSAERESAALDASPVSDFEAMFGDESSGETD
SAAVEAPTPSDFDLSSLSANDSNADADSWADNSSSLDWAFEAGEETTAEAQTPLFEWDEA
DSAVLEGLEVSVPDASVESRALDSPSASDFDGLLGDGLFGDSDSFDVSESATDHLFDTEI
DVSEEQPLTEEAVADDLLNFDWEGTGATESENFEDVFSSQTDEVPEAETWDDLLSATQES
DVPDTELTALSDDEVDTPVQAAAFDFEALEDETTTELNLDWETQESDHLFTESEADAHLD
ATAAQDSAADRSQSLEFDDLESMLDGGAADNSQSLEFDDLESMLDGGAADNSQALEFDDL
ESMLGGGEELAISGLDAWDTTSGNGEFDGLDEFADLEAMLAEAPSHPTTESSDLDVFQDL
DSLLEDQTQAPDSPAPAPVNRATSKASSLADEFGDLESLLKQADKSLGGPPSAMPDQSRT
RPSMRPRPPRVFEHTMRVPVKHLDSLSNLVGELVVNRNTLEQDQERLRQFLDNLSHQVLA
LSDVGARMQDLYERSLLESSLLASRPGHRSPGQSDLFSLPLHHSGEEYDPLEMDRFTGFH
LLSQEMIELIVRVRESASDIEFLVDETDQVARMLRQITTQLQEGLTRARMVPFAQNADRL
LRAVHEISRKLGKEAQLQVEGRETLIDKMILEHLYDPMTHLVNNALTHGIESPEVRKAAR
KPPVGRVTLRAFHQGNQTVISISDDGAGIDAERVRSKAIQQRLIKADDAKTLTNVELYDC
LFHPGFSTKDKADDFSGRGVGMDVVRTSLSEIRGTIHIDSTVGKGTTFTIRLPLTLSICK
ALCCLSDRARIAFPMDGVEDMMDILNDRVQTNAEGQSCIQWRDTLLPFHSLSDLLTYKRQ
LSRNTVYGGKREDDMISIVVLRSAGNFLAIQVDQVLGEQEIVIKQLEGPPPKPVGIAGAT
VLGDGRIMAIADVLELIDLANGRIRKDGGVTLWPREEPQVELPGEIIEAKSEPMVLIVDD
SITVRELLSMTFSKSGYRVEQARDGQEAWDKLRSGLPCDIVFCDIEMPRMDGLELLSRLQ
KDEKLANLPIAMLTSRGADRHRQMASQLGASGYFTKPYLEEVLLDAAQRMIKGEVLFNSN
A
Download sequence
Identical sequences K9WEU8
WP_015182882.1.75295 gi|428311162|ref|YP_007122139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]