SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311179|ref|YP_007122156.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311179|ref|YP_007122156.1|
Domain Number 1 Region: 51-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.97e-37
Family TK-like PP module 0.0056
Further Details:      
 
Domain Number 2 Region: 369-575
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.24e-32
Family TK-like Pyr module 0.017
Further Details:      
 
Domain Number 3 Region: 581-730
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000883
Family Transketolase C-terminal domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311179|ref|YP_007122156.1|
Sequence length 732
Comment phosphoketolase [Microcoleus sp. PCC 7113]
Sequence
MTVATQAPSFCEGIQYFGEALPGFDKLGKEPAIAQGQKAIAQPNDPKAVFQTLLAADALR
YLTLQVTASKASGHPGGFASQAEAYAALVMLGHKNILTEVGHHAPGFYSAMFLDRSLEDM
GISTVQQLRDRFREKHGLLGHLSGYIPGILAPAGPLGQGQHFAMAAALLHRDKLFAFTLG
DGGMGEPYPMSSMAHFHTAYPEVTNFLPVLVWNGYSQEHHSMVSTKSNEEMVEYWRGNGF
EEVILVNAKDFDDQNQPGDYVDSTAFSLEKRLEFTQAVLVAMDKAAKSALGGKLTVFIIK
QLKGAGVHARGAKSHNLYPKDTLDSPHIMEALKTRSLPIEAWELVRTNCERAGGGPAAKT
VVTEFELSLPELGELPLEEFAVGGDPKVSTTAMGRLVGKVGESDRNFLVTNADGNEASGI
ANINQALKIIHPTADTLYNQAPKGQVYEPLSEDACAGLAAGLSLMGARTLWCSYESFAIN
GLPIWQTVTQAMAELRRPTPSTITLYTAGALEQGRNGWTHQRPEIEAYFAAMMRNGNVFP
LFPPDANSIQACYEWALTTKNKGIVITASKSPLPIRTTFAQTREGLQNGAVVLHEVEGGK
QVVFAVIGDMTLIPVFEAAAHLETEGIGVRIVSVINPRRLYRPHDVAWDTCSESDSGFLD
DAGFAGLFDGDALIGVTGGASLMLEPIMLRSNCKRDTFAWKRGETTASAGELMAFNGITA
EALTKRAIELVH
Download sequence
Identical sequences K9WEB8
gi|428311179|ref|YP_007122156.1| WP_015182899.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]