SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311185|ref|YP_007122162.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311185|ref|YP_007122162.1|
Domain Number 1 Region: 1-359,387-411
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311185|ref|YP_007122162.1|
Sequence length 564
Comment phytoene dehydrogenase-like oxidoreductase [Microcoleus sp. PCC 7113]
Sequence
MQSYDVVIIGAGHNGLVCAAYLLKAGYSVLLLEKRSVPGGAATTEEVMPEEAPGFKFNLC
AIDHEFIHLGPVVEELELTKYGLEYLFCDPVVFCPHPDGKYFLGHKSVEKTCAEIARYSD
RDAKKYAEFIDYWQRVTKAITPMFNAPPKSIIDIAGNYGAQNIKDLLSVIGGVDKALDLV
RNMLTSPEDLLNEWFDSEFLKAPLARLAAELGAPPSQKTLAIGAMMMSLRHNPGMARPRG
GTGALVKALLNLVKSQGGVVLCDQHVEQVLVDDGRAVGVRVGGGQEYRANKGVISNIDAR
RLFLQMVDPADAHSADPNLRDRLERRIVNNNETILKIDCALSEVPRFERFDHKDEYLIGS
VLIADSVAHVEEAHSLATRGIIPDSNPSMYLDVPTVLDPSMAPEGKHTLWIEFFAPYQIA
GAEGTGLKGTGWTDELKNKVADRVIDKLADYAPNLKNAIMARRVESPAELGERLGAYKGN
YYHVDMTLDQMVFFRPLPEIANYKTPIEDLYLTGAGTHPGGSISGMPGRNCARVFLNTQQ
PIAQKLKDAGNTVKSAVESVFKIT
Download sequence
Identical sequences K9WG34
gi|428311185|ref|YP_007122162.1| WP_015182905.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]