SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311260|ref|YP_007122237.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311260|ref|YP_007122237.1|
Domain Number 1 Region: 800-1197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.71e-125
Family PFOR PP module 0.0000000193
Further Details:      
 
Domain Number 2 Region: 418-674
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.02e-80
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000045
Further Details:      
 
Domain Number 3 Region: 6-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.02e-79
Family PFOR Pyr module 0.0000000784
Further Details:      
 
Domain Number 4 Region: 261-416
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.57e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000794
Further Details:      
 
Domain Number 5 Region: 671-844
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.21e-23
Family Ferredoxin domains from multidomain proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311260|ref|YP_007122237.1|
Sequence length 1224
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Microcoleus sp. PCC 7113]
Sequence
MPLKNFATIDGNEAVARVAYRLSEVIAIYPITPASPMGEWADAWASAAQPNLWGTVPSVV
EMQSEAGAAGTVHGALQAGTLTTTFTASQGLLLMIPNLYKIAGELTPAVIHIAARSLAAQ
GLSIFGDHSDVMAVRGTGCGLLCSASVQEAQDLAAIATRATLESRIPFLHFFDGFRTSHE
IQKVELLSDDDLRAFIPNELILAHRDRALTPDRPVIRGTAQNPDVYFQARETVNRFYNAC
PGIVQQAMDEFAQLTGRQYQLYEYHGDPAAEQVIILMGSGCETVHETVDYLNARGAKVGV
LKVRLYRPFDGTRLVAALPESVKAIAVLDRAKEPGSTGEPLYLDVLSALVESNRQTIQVV
GGRYGLSSKEFTPAMVKAVFDNLTVDQPLNHFTVGIYDDVTHTSLNYDPSFSIEPDNVVR
AIFYGLGSDGTVGANKNSIKIIGEETDNYAQGYFVYDSKKSGSVTVSHLRFGPQLIRSIY
LVDSANFVACHQWEFVEKFDLLGTAKPEAVFLLNSPYNSEETWRRLPERLRAQILEKQLK
FYVINASQVAREVGMGRHINTVMQVCFFAIAGVLPREEAIARIKQSIRKTYGKKGETIVE
MNLKAVDRTLDNLYEVEYQNYQQAAIPSQVGEAPSPVPDTAPAFVRDVLGKMMARQGDDL
PVSALPIDGTYPSGTSKWEKRNIAQEIPVWDADVCVQCGKCVMMCPHAVIRSKVYEPEAL
ENAPETFKSANAKDHDWTNLKFTIQVAAEDCTGCGLCVDICPAKNRAEPRKKAINMAPQL
PLREQERENWDFFLNLPNPDRSKLKLHKIAQQQMQEPLFEFSGACAGCGETPYVKLVSQL
FGDRMLVANATGCSSIYGGNLPTTPWTHNAEGRGPAWSNSLFEDNAEFGLGFRVAIDKQM
EYARELLQELSSSMNGSSPIPVDLASAILNAEQKDEADIVEQRERVAILKQHLEEWCNQL
EGDQNLKSKIQTLKSLADYLVKKSVWLIGGDGWAYDIGYGGLDHVIASGRNVNILVLDTE
VYSNTGGQMSKATPRGAVAKFAAGGKPAPKKDLGLMAMTYGNVYVASVAMGARDEHTLKA
FLEAESYNGPSLIIAYSHCVAHGIDMTTGMQQQKAVVESGRWLLYRYDPRRTERGENPLI
LDSRSPKISVEQAMYSENRFKMLTRTKPEDAKRLVELAQADVNTRWQMYQYLAAQHLGKP
NGHHDGHTDAGATSSKQSEPSTAQ
Download sequence
Identical sequences K9WGA1
gi|428311260|ref|YP_007122237.1| WP_015182979.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]