SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311278|ref|YP_007122255.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311278|ref|YP_007122255.1|
Domain Number 1 Region: 135-317
Classification Level Classification E-value
Superfamily GAF domain-like 1.44e-64
Family GAF domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 326-513
Classification Level Classification E-value
Superfamily GAF domain-like 1.47e-56
Family Phytochrome-specific domain 0.00000278
Further Details:      
 
Domain Number 3 Region: 1059-1231
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-56
Family GAF domain 0.00025
Further Details:      
 
Domain Number 4 Region: 1426-1591
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-48
Family Histidine kinase 0.00021
Further Details:      
 
Domain Number 5 Region: 4-124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-34
Family BphP N-terminal domain-like 0.00058
Further Details:      
 
Domain Number 6 Region: 1235-1361
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.41e-31
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.038
Further Details:      
 
Domain Number 7 Region: 669-764
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.54e-28
Family Flavin-binding PAS domain 0.0016
Further Details:      
 
Domain Number 8 Region: 925-1034
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.54e-25
Family Flavin-binding PAS domain 0.041
Further Details:      
 
Domain Number 9 Region: 1358-1438
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.06e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 10 Region: 761-895
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.072
Further Details:      
 
Domain Number 11 Region: 527-636
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.03e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311278|ref|YP_007122255.1|
Sequence length 1594
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNHNDLLLSQSVDLTNCDKEPIHLPGLIQPHGILFVLQEPQLKILQVSNNTFNLLGIHPH
EILGKNFKDFLNSYLVHSIEKQLTEKFESINPINLSINTQKGELFFDGILHRSDGMLILE
LEPVTSKEFSNFFSFYHLLQAPITKIQKTLTLNELCQAIVKEVRKLTGFDRVMVYQFDAQ
DAGTVIAEDKLEGLSPYLGLHYPASDIPRQARHLYALNLLRLIPDVNYQPVELFPVDNPA
TNQPLDLSFSVLRSVSPIHIDYLKNMGVRASMSISLIRNQKLWGLIACHHHSAKYISYEV
RTACELLGKVMALELTSKADNEKLDYRIKLNSIQSKFVEAISQEESFVDGLLKERTNLLD
LVGAQGVAICTSENLTLIGQTPKLTDIQELINWLTKTINQNIFYTDSLPKLYPTAEKFKE
VGSGLLALSISKIQKYYVLWFRPEVIQTVNWAGNPNKPVEVEQDGTLRITPRKSFELWQE
TVRLKSLPWKSCEIEIALELRSAIVGIALRKADELSKVNQQLTLALSAAQMGIWDWDLLT
NQITWSSGHEQLFGLEPGTFEGTYEAFEACVYPEDREAIALAVEQARLEGQDYHHQFRVV
WADGSIHWIEGKGKFFYDADGNAVRMLGTVREISDRIARVAQLRLLESVVITTNDAVVIT
EAEPIDEPGPRIVYVNPAFTRMTGYTLEDVLGKTPRILQGEKTDRTVLNRIRTALQTWQL
SQVELINYRKDGSQFWVELSIVPVADEKGWYTHWVAVQRDITERKLTEIALQESQRFIQQ
IADTAPNLIYIMDIVQQRNVYLNRFGSRFFGCPSEEIQHLGSAFFADVLHPDDFRQLNEL
PERCATAKDGEVLENEFRMKNADGEWRWFHTWDVVFSRTAEGLPQQILGTAIDITQAKQL
EQARQQAEQQIRFQAGLLDAVEQSVIATDLAGNIIYWNRYAEVLYGWRVTEVLGRSIVDV
TPASTTQEQAVEIMVRLQAGESWSGEFWVQRRDGTTFPVLVIDSPIHDEQGELIGIIGVS
VDITQRKQTEAFLQHLNEELEIRVRERTQELERSQAALQQQMERERLMMAIAQQIRQSLD
LQEILDTTVTEVQKLLWADRVLVYRVWSNGAGRVIAEAVAPGCIKVLDIPLPTETFPEEY
RQRYAEGRIYTLTDLDHEEVSPCLANCLKQIQVRAKVVVPIIQQDTLWGLLIAHQCSQPR
EWQPWEIELLVSLANQMAIATQQSELYQQLQDELRERQQMAAALRQSEAEFRSLSENSPV
GIFRMDAQGRCTYTNPRCQVICGYTFEEALGEGWLKFVHPEDREWLIEQWSQTLSEQQEF
SAEVRYIHQDGTIRFAQMRTSPLFSASSQLMGHVGTVEDVTERRAIEQMKNEFISIVSHE
LRTPLSSIRGSLGLLAAGVFKHKPESAQQMLDIAAHDTERLVRLVNDILDLERLESHKVN
LVKQWCDAATLLQQSVETVQSLAVEGNIMLCVEPTSVQVWADRDRILQTLVNLVSNAIKF
SPPQSTVTLSVQDQADQVLFQVKDQGRGIPADKLNTIFGRFQQVDASDSRQKGGTGLGLA
ICKSIVQQHGGKIWVESVVGEGSNFYFTLPKPLD
Download sequence
Identical sequences K9WGD5
gi|428311278|ref|YP_007122255.1| WP_015182997.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]