SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311316|ref|YP_007122293.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311316|ref|YP_007122293.1|
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-60
Family Protein kinases, catalytic subunit 0.0000714
Further Details:      
 
Domain Number 2 Region: 1649-1816
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-36
Family Histidine kinase 0.0051
Further Details:      
 
Domain Number 3 Region: 1356-1537
Classification Level Classification E-value
Superfamily GAF domain-like 4.8e-26
Family GAF domain 0.0065
Further Details:      
 
Domain Number 4 Region: 293-422,466-592
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000448
Family Extended AAA-ATPase domain 0.051
Further Details:      
 
Domain Number 5 Region: 1547-1587,1617-1647
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000051
Family Homodimeric domain of signal transducing histidine kinase 0.014
Further Details:      
 
Weak hits

Sequence:  gi|428311316|ref|YP_007122293.1|
Domain Number - Region: 1236-1303
Classification Level Classification E-value
Superfamily TPR-like 0.0091
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311316|ref|YP_007122293.1|
Sequence length 1817
Comment ATPase [Microcoleus sp. PCC 7113]
Sequence
MIKLPGYLIINLLYDGSRTQVYHGRQNLTQQSVAIKILKSEYPTFSELLHFRNQYTIAKN
LRLPGVIQFYSVETYRNGLALVMEDMGGVSLQDYIRGQPLALGEFLPLAMQLAQTLEGLY
QNGVIHKDIKPQNILINPETKQIKIIDFSISSLLPKENPILQNPNGIEGTLAYMSPEQTG
RMNRGIDYRTDFYSLGVTFYQLLTGQLPFWSTDPIELVHSHIAKVTIPPIEVNPAIPKMV
NDIVLKLMAKTPEERYQSAYGLRHDLENCWQQWQTQESILSFELAKRDICDRFVIPEKLY
GRETEVATLLAAFDRVSKGTTEMMLVSGFSGVGKTAVVNEIHKPIVRQRGYFIAGKFDQF
KRNIPFSALVQAFQTLMQQLLTESDVQLHQWKAKILAALGENSQVLVDVIPELERIIGKQ
PPVPELSGSAAQNRFNLLLQKFIAVFTNQEHLSTSSRYPIIHTPLVIFLDDLQWADSASL
RLIQLLMSETQNSYLLIIGAYRDNEVNLAHPLKVTLEEIRKANEDRQTAYLRVNQITLTP
LGQPDLNRLIADTLSCPLERAKPLTELVSQKTKGNPFFTNQFLNFLYKEGLITFDFNHKY
WQCDIALLRTVAASDNIVEFMASQLQRLPLKTQCVLKLAACIGNSFDLQTLSIVYEKSQL
ETAADLWTAMQEGVIIPISEVYKFFHSEDNQQDSNLLPITHYPLPRYKFLHDRVQQAAYS
LIPPNQKQHTHLKIGQRLLHNTSEVEREEKIFEIVNSLNYGVELICDCHEREELAQLNLI
AGRKALSATAYAAARGYFTVGRELLADDGWQTQYDLTLALSVAAVEAAYLNTDFQQMEEL
ADVVLHQARTLLDKVKVYEVQLAACTAQVKPKQAVEMGLEVLNLLEVSFPRQPSSLDIQQ
KLQEMASLFKGRKIEDLINLPAMVAPDKLASLRILSSLVSPAYITAPALLPLIVLKMVHL
SIHYGNAPLSCFAYSLYGLILNGVLLEIDLGDEFGKLALKLVDQLNANALKTKVFYTVAA
HVLYGKNPIKNCLPLLQEGYSRGLETGELECGYSAKEKSQISYFSGLELTELEPKIASFS
QSLIQLRQEAALNYNQIIHQAVLNLLGRSENPCLFMGEAYNEQTMLPFHQNANDRNGLHY
FHFHKLIICYLFGEVQQALHNAIQAEQYLDGVIGMLNVPLFYFYDSLVRLAVYPNVLKSE
QEQHLVKINSNQEKIQLWAHHAPMNFLHKFHLVEAEKFKVLNQNFEAIDSYDKAISLAKE
YEYVNEEALAHELAAKFYLAWGKETIAQAYLIHAYYAYARWGAKAKVHDLEKRYSQLMTP
ILQREKISKGMSSTLSHLTTETLSTSSNPVSQFLDLSSVLKASQAISGEIVLDQLLSTLM
QVIIENAGAQKGVFILQKQDHLVIEVVAQSSPTKVSVLPSVPVESSTDIPLRAINYVQHT
RETLVLDNATSQAYLAAEPYIIQHQTKSLLCTPIIHQNKLIGILYLENNLMIGAFTRNRI
EILGLLCSQAAISLENAGLYQKSQRYAQQLEQSLQQLKQTQLRLIQSERMSTLGQLVAVV
AHEINNPVGFITSNLGYAQKYVQDMLSILQLYQHKFTQPGEEIEQEIASIELEYLMEDLP
NILSSMKEGAERISHISTSLKTFSRSDTFDKVDFNIHEGINSTLTILKYRLKANDKRPAI
EIIQEYGNLPLVKCYPGQINQVFMNIIANAIDALDELNQGYSYEEIQAHPNRITIHTALS
VDHQNIVIRIQDNGAGMSEEVKQLVLDQSFTTKPVGQGTGLGLSISRQIVEEAHGGQLTY
SSNVGQGTEFVITLPLH
Download sequence
Identical sequences K9WH80
gi|428311316|ref|YP_007122293.1| WP_015183032.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]