SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311329|ref|YP_007122306.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311329|ref|YP_007122306.1|
Domain Number 1 Region: 9-137
Classification Level Classification E-value
Superfamily Ava3019-like 2.62e-44
Family Ava3019-like 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311329|ref|YP_007122306.1|
Sequence length 140
Comment hypothetical protein Mic7113_3158 [Microcoleus sp. PCC 7113]
Sequence
MPTQNSTPLTLQEAQELLKPFNCIENKSITSESEKALIRQALLLLTEHSDYQILGICADT
AAQGLSALKSYAEALGYPSLFDLQPIEGSVYIKFNPKTGLCYLDSYTGIHRGVLVSCQSA
YEDGINEMYGHLPLDLFHVS
Download sequence
Identical sequences K9WER5
gi|428311329|ref|YP_007122306.1| WP_015183045.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]