SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311431|ref|YP_007122408.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311431|ref|YP_007122408.1|
Domain Number 1 Region: 326-489
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-38
Family Histidine kinase 0.0024
Further Details:      
 
Domain Number 2 Region: 253-337
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.34e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|428311431|ref|YP_007122408.1|
Domain Number - Region: 221-267
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00785
Family HAMP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311431|ref|YP_007122408.1|
Sequence length 491
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MVKLRSFRIRIALLSAVLAGGALVGFGLISWWLIYEAKVSRLDAELESQLMRAGRPRSSE
GWQSYETSLGQAFGTNGKTAIAILVIGADGNILYRSQQWATDLDVTNLWTSRPQLPPFPS
PRFERQTAPFPAAKPPFPERLQPPPEVPPPTPRFATQHTTTGTWRVGAVTTPFTQVAIAV
SLNAVTQEMAVIRNIFLISIPGVLLLVAGGAWGIAGSSLHSIRRLTTVIGNVTASGLEQR
VPIGTTDVEFVELIQVFNQMLERLERSFKQASRFSGDAAHELKTPLAILQGELERTLQQA
EPGSQVQQRLSNLLDEVRRLSGIVRKLLLLSLADAGQMNLHRVEVDLSGLLMEMLEDIEL
LAPHLEIQTEIADALCVQGDHDLLIQVLQNLISNAIKYNLPNGWIRIDAHRQGTTVSITI
SNCSKDIAVSDQSRIFDRFHRGDPARTRKVEGIGLGLSLAREIARAHGGDLTLDSPLSGQ
TAFTLTLPVGL
Download sequence
Identical sequences K9WHK2
WP_015183146.1.75295 gi|428311431|ref|YP_007122408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]