SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311443|ref|YP_007122420.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311443|ref|YP_007122420.1|
Domain Number 1 Region: 1535-1702
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.2e-46
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 1723-1844
Classification Level Classification E-value
Superfamily CheY-like 6.55e-33
Family CheY-related 0.0072
Further Details:      
 
Domain Number 3 Region: 934-1061
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.71e-31
Family Flavin-binding PAS domain 0.02
Further Details:      
 
Domain Number 4 Region: 1326-1451
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.03e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.035
Further Details:      
 
Domain Number 5 Region: 674-801
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.29e-29
Family Flavin-binding PAS domain 0.04
Further Details:      
 
Domain Number 6 Region: 413-537
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.66e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.058
Further Details:      
 
Domain Number 7 Region: 1060-1188
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.71e-25
Family Flavin-binding PAS domain 0.076
Further Details:      
 
Domain Number 8 Region: 1464-1546
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.42e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 9 Region: 1187-1318
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-17
Family Heme-binding PAS domain 0.081
Further Details:      
 
Domain Number 10 Region: 5-146
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000000027
Family CheY-related 0.0023
Further Details:      
 
Domain Number 11 Region: 551-662
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000332
Family BphP N-terminal domain-like 0.084
Further Details:      
 
Domain Number 12 Region: 810-935
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000279
Family Heme-binding PAS domain 0.031
Further Details:      
 
Domain Number 13 Region: 282-415
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000171
Family Flavin-binding PAS domain 0.049
Further Details:      
 
Domain Number 14 Region: 167-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000114
Family Heme-binding PAS domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311443|ref|YP_007122420.1|
Sequence length 1857
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLTHRTVLVIADSAESDRVYEHQLQQDSNVAYKILTEQYDTPILALSQSQQIDGILLELH
FPHSNSIQLLRQLKEQMGDRCPPIVVIDSDDAEVAVRAFKNGAADYLVKDRMTPDDLRLS
MHSAIENAELRRELERSQEQFQTSVENMLDCFGIFSAMRDESGQIVDFRIDYLNGAACEN
NRMPKAMQIGRGLCEVLPAHRESGLFDEYCRLVETAEPLIEDSLIYDDTYGKQHLVRAFD
IRATKLNDGFVASWRDVTDRKRLELELSHTVTDLQRHEAAIQQLNRDLTNRVAELQSLLD
IIPVGIAIATDPSCTQMQNNAYLRQLLGVDPGSNISKSAPVDEQPPYRVFQDGREVPAED
LPMQVAVRLGIDVRDAEFDILLPNGTVHQLLSYATPLRDDQNQIRGVIGAFLDITERNQD
AAALKASQQRYRELAEAMPQMVWTADATGAVNYCNQRWYEYTGLNEAESMGLAAANTVHP
DERDRSLTQWSEAIANGQSFEVEYRLCHWGGEYQWFICRAIPTRDSQNQLTGWIGTITNI
DDIKRSEALVQQSEQQLQRQLAEIEAIYQSAPIGLNVLDTELRFVRINQRLADINGLPIE
AHLGRTVRELFPNLADTLEQLLHPILKTGEPLLNVEIQGEIPAQPGIKRTWLEHFLPLKA
GERVVGISTVCEEITERIEVEAALRQSEERFRHMADNAPVMIWVTDATGYCTYLNQGWYD
FTGQTEATGLGFGWLDAVHPEDSESSKNVFLSATHRQEAFRLEYRLRRKDGKYRSCLDAA
SPWLGEDGEFKGYIGSVIDISDVYDELRLRKQAEEALRVSEERYRTLFENMNEGFCVAEV
LFDEHNKPIDYRLLEINSVFEKHSGLKNAQGKTARELHPELEQYWIDLYGNVVLTGEPVR
YENYSEALNRWFDVSSFRIGPPGSRKVAILFEDISKRKQTERELQESEMRFRTLADNISQ
FAWMADENGQIFWYSKRWFDYTGTTLEEMEGWGWQKVHHPNHVDRVVEKISRCFETGETW
EDTFPLRGKDGQYRWFLSRAIPVRDEQGKVLRWFGTNTDITERKQTEAALQASEERYRSL
IEATAQIIWNEQGDRGEFTTPQPAWSAFTGQTYDELKGWGWLNAVHPDDRAMTTQAWLIA
LENRALYEVEHRVRRHDGVYRHMSVRAVPVFEENGSIREWIGVHTDVTDRKQAEAALHQS
EDRLRMAIESAQLGTWDWNLITNKLTWDTGCKAMFGLPPDAESSIEVFFEGLHPDDRERL
EQVMQWSFNPASGGNCDTEYRTIGIQDGIERWIAAKGQAYFNAAGNPIRFIGTVMDITET
KRREAERKQAEEARRESEIRFGTLASHAPVGIFMTDPQGNCLYVNERWCEMAGMSLEAAQ
ATGWVSALHPDDRERVADLWYQAAQNKQVFAAEYRFQTPQGKVTWIQGSATALQRGTGEV
TGYLGTLTDITERKQVEAEREQLFQQEQAAREAAERANRIKDEFLAVLSHELRSPLNPIL
GWTKLLQMRKFDETKTAEALATIERNAKVQTQLIDDLLDVAKILRGKLSLNVNSVNLSSA
IAAAIDTVRTAAVAKSISLHPVLPNIGQVSGDAARLQQIVWNLLSNAIKFTPKGGRVDIQ
LNRVGNQAEIAVRDTGRGINPDFLPHIFESFRQEDASITRQYGGLGLGLAIVRQLVEAHG
GTITADSPGEGLGAAFTVRLPLLDVAPEIQQTDELPQDKLDITGIRVLAVDDDPDARELL
TVLLTQYGADVLTVASAVEVLEHLPSFQPDVLVSDIGMPEVDGYTLIQQVRALPSKGGQI
PAIALTAYAREDDRDRAITSGFQRHVTKPLEPEQLVQAVLALTRSELNHSLNQNYSV
Download sequence
Identical sequences K9WGV9
WP_015183158.1.75295 gi|428311443|ref|YP_007122420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]