SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311469|ref|YP_007122446.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311469|ref|YP_007122446.1|
Domain Number 1 Region: 31-355
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.01e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|428311469|ref|YP_007122446.1|
Domain Number - Region: 539-625
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0408
Family P22 tailspike protein 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311469|ref|YP_007122446.1|
Sequence length 793
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSKSSNFGLERTGLLGAIWAFIQLCLFVALPNIPTLAQITPDTTLGAEGSRLTPGANVQG
LPAELIEGGALRETNLFHSFSEFNVNNGQRVYFANPTGIENIFSRVTGNNVSNILGTLGV
NGNANLFLLNPNGIIFGSNARLDIKGSFLATTAKSFQFPGGTQFSATNPEAPPLLSINVP
LGVQYGAQPGTITVNQANLNVGSQQSLILLGGDVELNGGRLNASGGLIELGGLAGEGSVG
LDVEDGFLSLRDFTGTHGNVSISGSTISATATGNSDTASGDIQMTGRNVQISDSTIASIG
NDESYGTITIKASDSVFLNNAILDTQNKNGTGGDVLINAPNQISIANSKISSEGYFGRIS
IGSLDPDEEDPIKPGTVVIDNSKLTSETASTDGNLPDQQGLGLVSIRASDSVEIKNGSQL
NATTSGIGDAGNIAISAPNGTVVINNRSKLLSEATKDAQGDVGYIKITARNLLIDEAQVS
INDQSLDNPTNATNVDINDLDSFDDIDSFDDIDSFDDIEKLPGRIYISAEQMTLDNQARI
EANSASVDGGNIYIEASERLMLRRGSLISAEADTAQQGGGGKGGNVTINAKDGFVVAVPS
ENSDIIANAFDGDGGKITIFANKIFGLKRQRGQSTSQLRSNRSSDISASSKFGFEGEIKI
NTLALDPAQGLVELPVTLVDPTGLIAQGCQSRNNGVAKGQSTFVATGRGGLPPSPDDLLS
TGATPPPWVTRDSGRVSKAAGVATLPSRTPTPPLVEAQGMVIGSKGEIILTAGVTTTTPH
PSGFSASGCSGER
Download sequence
Identical sequences K9WF59
gi|428311469|ref|YP_007122446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]