SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311538|ref|YP_007122515.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311538|ref|YP_007122515.1|
Domain Number 1 Region: 843-1027
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.75e-57
Family Adenylyl and guanylyl cyclase catalytic domain 0.00024
Further Details:      
 
Domain Number 2 Region: 484-650
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.04e-50
Family Histidine kinase 0.00054
Further Details:      
 
Domain Number 3 Region: 688-816
Classification Level Classification E-value
Superfamily CheY-like 4.84e-40
Family CheY-related 0.0007
Further Details:      
 
Domain Number 4 Region: 411-495
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.18e-19
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Weak hits

Sequence:  gi|428311538|ref|YP_007122515.1|
Domain Number - Region: 1044-1085
Classification Level Classification E-value
Superfamily TPR-like 0.0316
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311538|ref|YP_007122515.1|
Sequence length 1099
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MKFVVSWTHTRMAWFIGALMVVLLSILPFTLAPSQAPTQAATSPVELTQGWQYRWDESPV
DETGIPLCAQETISSPNWQSFRFPKKLDKPQEAKILWLRVPLPAGQWQYPAVYLRSIPYI
LGAYIQNQRIYSQYYLTPFGQAQLSHYQWPIVTLQSDFSNQFLCFQVYANNSDSLYIGLF
DRVTVGSQVDLLKRLLQQELDEILGVFFAFLGLISILLASNRQEKKSYLSFGVLAILIAL
YTIARSDLITLFIKNYILLDYTHYISFYLMPISACFFFEEMFGFRYKRVIQGLWKIHLIY
AVIALPLVVFQVVSWSSTVLPAQILLLSSALILLTISIKNSHQGNWDAKLFTTGFSTLTL
CVIHDVLIYIFEPVNWYQKFYPWGTLIFILCLGFILERRFSEARKRLQAYAIELEKKNAD
LQKINQLKDEFLANTSHELKTPLNGIIGIAESLIDGATGPLSQKTLFNLSLIASSGKRLS
QLVNDLLDFSQLKHKNLELKIQVVGIREITNVVLMLSQPLVGKKDLRLVNKIDPDLPTVK
ADENRLQQILYNLVGNAIKFTPSGTVEVSAAAVNQELEITVADTGIGIPTDKLDRVFESF
EQADGSIAREYGGAGLGLAVTKQLVQLHNGRIWVESTVGVGSRFIFTLPISQGQVERKRQ
KEVSKFQMSSVIKEAPNNFLIEPEKLAPANKGFQILIVDDEPVNLQVLVNHLSLQNYAIT
QAANGMEALELIDRGFKPDLILLDIMMPKMTGYELCQKIRERFPANELPVVLLTAKNQVS
DLVEGFSAGANDYLTKPVLKNELLARIKTHIRLAKINEAYGRFVPHEFLQFLERESIIDV
QLGDQVQKEMTVLFADIRSFTNLSEKMSPKENFDFLNAYLSRVSPVIRKYHGFIDKYIGD
AVMALFPQSADDAVQAAIEMQKQVSLYNVYRQQTGEEPIAIGIGLHTGSLMLGTVGEPER
MEGTVIADAVNLASRLEGLTKLYGVDILISEKTLYGLDDSQKYHYRFLGRVRVKGKSQPV
DVFEVYEANPEPVIHLKRQTRTEFERGVALYVDKNFAEAQDVFQDVLQRNEQDKVARLYI
ERCIKAQRFGVSELDIVIN
Download sequence
Identical sequences K9WH72
WP_015183252.1.75295 gi|428311538|ref|YP_007122515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]