SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311546|ref|YP_007122523.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311546|ref|YP_007122523.1|
Domain Number 1 Region: 889-1083
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-38
Family Histidine kinase 0.0056
Further Details:      
 
Domain Number 2 Region: 604-768
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-26
Family GAF domain 0.0069
Further Details:      
 
Domain Number 3 Region: 185-299
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.7e-23
Family Flavin-binding PAS domain 0.055
Further Details:      
 
Domain Number 4 Region: 294-424
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 
Domain Number 5 Region: 423-543
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.55e-18
Family Heme-binding PAS domain 0.035
Further Details:      
 
Domain Number 6 Region: 36-164
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000533
Family Heme-binding PAS domain 0.022
Further Details:      
 
Domain Number 7 Region: 794-840,870-900
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000051
Family Homodimeric domain of signal transducing histidine kinase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311546|ref|YP_007122523.1|
Sequence length 1107
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKEFADQIAAMRDQLRQCAERTAALKATNEQLLREVIQRQRAEEELEQLLSLLRGTLEAT
ADGIIVSQNGKHIATVNRKFVEMWSIPESVITARDLSLVLPLILEQLKDPDAFLRETQGL
LSHLDAEGHGIFELKDGRIFERYSLPHRIGGNIVGRVCSFRDVTLAKRKEAELAESQRRL
ASLINSLPGIAFSCSNDPEWSMRYLSEGCLNLTGYTNEELLESGVNSYNSITHPEDLPKV
LSTLEQAVANKQPYVVEYRIHTQSGEEKWVWEKGSGVFDNNGQVIGIEGFITDISDRKQS
EKAFQEKEEFLELVLENIPQFIFWKDRNSVYFGCNRNFALAAGCSTPEEIVGKTDYDLPW
KQEESDFFRECDARVMETDTAEYHIIEPQLQANGKQAWLDTNKVPLHDAQGKVVGVLGTY
EDITERRLSELELQQSEQKYRNLFHNSLVGIFRNSLVDGTVLDANEAVLKMFGFDAYEGV
KSVDLYANPADREILKQQLLEKRFVENFEVQARRKDGSLFWVSYSGKLYAKEGYLEGVMI
DITERKQAEEALKTAKQELEIRVEERTTELRQAIRKLQGEIEERKRTEAELQRSEARFRD
LACQEALLNRLASQIRNSLALETILETAVQEIYNRLAIDVCVFAWYRKDGTSSGWDVVKE
AKNPDLPSFLGLYPLESWRPFTCKLVDREEFQVDQVTQNHETVQQTRLPYGTTALLSLPV
ETQSGQLGTLTCGRLVSWQSWTDEELELLQAVANQLAIGINQAQLYEQSRIAATTAQTKA
TQLEAALRELQQTQSQLIQSEKMSSLGQLVAGVAHEINNPLNFIHGNLTHINQYAKDLLN
LIQLYQEYYPHPAREIQAEIEAIDVDFLKEDLPKILSSMTMGTDRIRQIVLSLRNFSRAE
QTDRKWVDIHEGLDNTLLILGHRLKDKAHRPSIEIIKEYGNLPLVRCYPGQLNQVFMNIL
TNAIDALEMRHESWELGDERGSSYFQLPTPQSQLPKIWIRTEVNGSHQLVIRIADNGLGM
TQEIQRRIFDPFFTTKPIGSGTGLGMSISYQIVVQKHGGQLKCISAPDQGTEFLIYIPIQ
PPKSSGLLQEGLAGTLTHQEVINLTAC
Download sequence
Identical sequences K9WHY7
gi|428311546|ref|YP_007122523.1| WP_015183260.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]