SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311548|ref|YP_007122525.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311548|ref|YP_007122525.1|
Domain Number 1 Region: 849-1042
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.14e-47
Family Histidine kinase 0.00083
Further Details:      
 
Domain Number 2 Region: 1193-1312
Classification Level Classification E-value
Superfamily CheY-like 5.98e-40
Family CheY-related 0.0012
Further Details:      
 
Domain Number 3 Region: 648-770
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.05e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.071
Further Details:      
 
Domain Number 4 Region: 276-392
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-25
Family Flavin-binding PAS domain 0.042
Further Details:      
 
Domain Number 5 Region: 387-513
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.89e-25
Family Heme-binding PAS domain 0.032
Further Details:      
 
Domain Number 6 Region: 1058-1173
Classification Level Classification E-value
Superfamily CheY-like 6.69e-24
Family CheY-related 0.002
Further Details:      
 
Domain Number 7 Region: 778-861
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.16e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 8 Region: 544-654
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.041
Further Details:      
 
Domain Number 9 Region: 185-261
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000124
Family Heme-binding PAS domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311548|ref|YP_007122525.1|
Sequence length 1315
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQRFLQAFFVSNPFIPHGHCYLWKPGLVGLHLISDVLIAIAYFSIPLTLIYFIRKRQDIP
FNKIFLLFSAFIVACGTTHLMEVWTLWHPIYWLSGLLKAITAIVSLYTALMLVSLLPKAL
ELPSLAATNQALQTEIVERQKSEAKSRAILATIPDLMFKTNAEGVYLEYFTPHRTGDLLP
QTVDPIGRRMSELLPPDIAQRHIEHIQRAIATNELQTYEQQIQIGDRFQDEEVKVMKCGD
DKVLFMFRDISDRKQAEKERERSQMLRLELHLLENILEISLAGYFDWDIPGDREYLSPTF
KRMFGYDDDELPNTPQTWQSLILPEDLPGVLESFDQHVTSRGQIPYYNEVRYRHKNGSTI
WVICSGRVIEWDRDGNPLRMIGCHIDITERKQIEKALKSSEARYRAILEDQTELIVRFLP
DTTIVFVNEAYCRYFGIQREELIGKSYAPIIFEDDQETVAQAIQSMSAENPTVTIENRVI
INGEIRWTQWINRMLFDELGQFVKLQSVGRDITELKKTEEALRISEEQLGNLSDRLALAI
KSGAIGIWECHVGCHVPIWDDRMYELYGLQTSDFSGPLDEAWRKAVHPDDLAPVRAAVRL
TWQGKKEFDTEFRVVHPDGTIRFLKAHALVQRNEQGEPQCMVGINYDITDRKQAEQALQE
LNTAMQNAVEGISRIDINGYYISMNRAYANLCGYEPEELIGQLWQQTVHSDDLPDMIAVY
QQMLETGKVEAETRGVRKDGSIFYKQVTMITAYDQQGNVTGNHCFMKDISDRRYAEAQLR
QTNVQLARATRLKDEFLANMSHELRTPLNSILGMSESFQEGVFGSINERQAKAIATIERS
GKHLLELINDILDLSKIASGKLELEISNAPVKSLCESSLAFIRQMALKKNIRLNTRIPKT
LGSIQVDERRLRQVLINLLSNAVKFTLEGGTVTLEVRLEAGEAEEATSPVSPSSPSSSPH
LCFSIIDTGIGISPEDIGKLFQPFIQLDSRLNRQYTGTGLGLALVQQIMALHGGTVSVSS
EVGQGSCFTVRLPYRTSDSTPATPITASCPSPKLASDNVQVLIIEDSIPATDQIIRYLSE
LGMQSIVYPRGEGAVGKVKRVQPALVILDLLLPNMSGWDVLAQLKTNPQTQKIPVIIISV
MDERSKGLSQGAFEHLVKPITRAQFQATLEKLRYPAPAGSPSLIGVSTPAREKPLILVAE
DNQANIDTMSDYLENRGYQLLLAKNGQEAINLAKSQRPDLILMDIQMPGMDGLEAIRRLR
DEEQLTRLPIIALTALAMRHDREKCLSAGANEYLAKPVKLKQLTAMIQQLLKGNI
Download sequence
Identical sequences K9WH82
gi|428311548|ref|YP_007122525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]