SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311656|ref|YP_007122633.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311656|ref|YP_007122633.1|
Domain Number 1 Region: 99-369
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-22
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 2 Region: 7-72
Classification Level Classification E-value
Superfamily WGR domain-like 0.00000000314
Family WGR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311656|ref|YP_007122633.1|
Sequence length 473
Comment hypothetical protein Mic7113_3501 [Microcoleus sp. PCC 7113]
Sequence
MAEEKTYLELSQTEGSSHKFYEVIVNDTQVTIRYGRIGDSGQTQSKTYPTPEKAKADATK
KINEKLKKGYEHAVIGVRQKRPVTRRQVTSTTSTAKQAPILWKFASGSSAFGIFIDAERC
WVGNQAGKVFALNPQGQVLNQFKLPDGVKCLVADDVWIYAGCDDGNVYDLTGKLPRLAYA
IDEHVDIFWLDINDGVLGVSDANGGVTTIDHDDESQWTRLSQGQSGWMVRCDQSGVYHGH
SAGVTMYDAKEGRMLWHQKTKGSVLFGWQEASFVYAGTSDKKVYCFSKKGEVGPVYSCDA
AVYSCATASDGKYVFAGDNSSSIYCFNQAGERLWKLGTGCGSAFSMQFFDQRVYIVTTDG
SLACIDASDAAIAAAQAGTVPQATLIKAPKGEGAAPSATLETTADTTQGVIVECFREGGK
LRVRIVSPGYNPSWNVQFPKDIRKEGDRYLVQEVRESARGGFYRAYGDIKKLV
Download sequence
Identical sequences K9WI81
WP_015183369.1.75295 gi|428311656|ref|YP_007122633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]