SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311673|ref|YP_007122650.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311673|ref|YP_007122650.1|
Domain Number 1 Region: 344-505
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.69e-43
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 2 Region: 968-981,1046-1146
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 3.01e-25
Family Phosphorelay protein-like 0.054
Further Details:      
 
Domain Number 3 Region: 904-990
Classification Level Classification E-value
Superfamily CheY-like 3.84e-24
Family CheY-related 0.013
Further Details:      
 
Domain Number 4 Region: 5-162
Classification Level Classification E-value
Superfamily CheY-like 1.85e-21
Family CheY-related 0.0039
Further Details:      
 
Domain Number 5 Region: 276-356
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.12e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0014
Further Details:      
 
Domain Number 6 Region: 152-272
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-16
Family Heme-binding PAS domain 0.076
Further Details:      
 
Domain Number 7 Region: 605-679,716-761
Classification Level Classification E-value
Superfamily CheY-like 0.00000000868
Family Receiver domain of the ethylene receptor 0.065
Further Details:      
 
Domain Number 8 Region: 790-833
Classification Level Classification E-value
Superfamily CheY-like 0.000000047
Family CheY-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311673|ref|YP_007122650.1|
Sequence length 1153
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MEAQSLKVLLVEGNCQEAAHFETFLSQARRISIELTHAQRLDQTLKYLEQNGFDVILLDL
CLPDSQGMEAFVSIRTKAPLTPIVVLTDLEHEPLAIKAMTSGAQEYLIKAEIDSPLLVYA
LRYAIERHQAQIALAKSQQQNMRETYGEVRLRQQVEQALERERQQLREIIANAPVAIAMF
DTQMRCLVHSHKWSMDYGLEGQSMMGRTLCEVFSDFPHRWQAVVQRALNGEVLSQPEDKW
EREDGSTLYLRWAVQPWSTPEGSVGGVVIATDRINELVEAREAALENSRLKSQFLANMSH
EIRTPMNGVLGMTELLAKTDLNPEQVDFVQTLRVSAENLLTLLNDILDFSKLEASEMRLE
IQEFDLNRCIEDVADLLATAAQSKGLELAVLIDNNVPRQLLGDAHRLRQILMNLVGNAIK
FTFAGEVVIQVSLEFETSTYSELRFSVTDTGIGIAPADQKKLFQSFSQVDTSSTRQHGGS
GLGLAICKQLVELMGGEIGVASRGGAFVAGRWSVKVASQPGKKSRKTTDFQPRGAETPEK
PEKFFPSCVLSCSAELPKITPPTLPTPLPLSSCPKQGSTFWFTLPLVKQASNLATPPPAL
DLIGLKLLIVSGSATIRKVVHSLAIFWGMDVLEASSCEEAVKVWRSVERKNQFIDVAIFD
LNLLDRESESVRAALALVLQTQSTNQAATDLTRNTGTNAWKSVNSPGSSHTTGLQCSTKW
LLMNSVQERSLALRLMDLGFSGCITKPLKASKLLGCLRQVLMPLDELKHRSQVTVLQPPL
LTPKNVSYRSKVKILLVEDTPTNQKVVLNQLKMLGYEADCAVNGREALDLLTRCLSLAGT
SEQKLLPGGDSERDALVMASQWDEARIGEFPHVTPELGVDNAPIVANAWRTLRTAPLEPS
RAAIRSLMPSSAVPYDIILMDCQMPIMDGYEATQHLRAFEGASRRTVVIAMTANALVGDR
EKCLAADMDDYISKPVRLEELEQVLERWLPPRVKESAGVGIKQPEFPSGHLNMATSQNSQ
PLTPNYYHPSSPLTLSPSVAKQAKKVPVDLERLSELSRGDTEFLKELLQVFLEDALVYLE
ELKNALAAGDCTTVARRAHQLKGSSATVAIYQMPEIAAQLERQAEENQLLGASELLTELD
EILECIQAFISEG
Download sequence
Identical sequences K9WHJ5
gi|428311673|ref|YP_007122650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]