SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311693|ref|YP_007122670.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311693|ref|YP_007122670.1|
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.09e-19
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311693|ref|YP_007122670.1|
Sequence length 104
Comment nucleotidyltransferase [Microcoleus sp. PCC 7113]
Sequence
MTAINLKTEVSEDAIASFCQRWKITELALFGSILRDDFRPDSDVDVLVSFAPDAKWSLWD
IIAMKEELETLFGREVDLVQKDCLRNPFRRYEILSTKQVIYAAQ
Download sequence
Identical sequences K9WHL2
gi|428311693|ref|YP_007122670.1| WP_015183406.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]