SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311759|ref|YP_007122736.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311759|ref|YP_007122736.1|
Domain Number 1 Region: 969-1152
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.34e-50
Family Adenylyl and guanylyl cyclase catalytic domain 0.00033
Further Details:      
 
Domain Number 2 Region: 269-444
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.24e-30
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 3 Region: 62-183
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.35e-17
Family Heme-binding PAS domain 0.047
Further Details:      
 
Domain Number 4 Region: 196-281
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000746
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 5 Region: 884-934
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000458
Family HAMP domain 0.0031
Further Details:      
 
Domain Number 6 Region: 657-743
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000000576
Family Sensory domain of two-component sensor kinase 0.04
Further Details:      
 
Weak hits

Sequence:  gi|428311759|ref|YP_007122736.1|
Domain Number - Region: 1170-1212
Classification Level Classification E-value
Superfamily TPR-like 0.0374
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311759|ref|YP_007122736.1|
Sequence length 1229
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSDSTHSEAPRPSSNNPQIEQLRLEITHLSQELAKVQQEKADLEIMLETIADHGDVIEEK
LQKEAEAAKQESRERFRLIAEATPITILISRLSDGEVLYANAAATSMFSLPMQELLGRSV
LDFYSDPNDRKKLLDIYAKNGSLRNYEIRLKKQDETVFWGAISLQPFSLYGEEVLLTAIL
DVTKRKQSEVDRIRFTQALKEKHGQLKRLSELKDEFLINTSNELCTPLNQMVHLVQSLLE
KEAGEFSQTQQQKLSTIAQSGHQLFNLVNNIRDFSKLRQGDMELHWQAVNVRSLTEKVLQ
SSQTLVSHKDLQLVNSIPVDLPNINADEQRLQQILQSLVAQAINLTEHGCVEISAVVDEF
QQQGTENLEQLVITVADTGAGISEDKLEDILELFNQADYLAIQQSETNDLQLSLTKALVE
LHGGKIWVESEVGFGTRFIFTLPFHGTVTDTGRQAAIAPTSSHLQPSERAAIKSIMSATK
TPILIATDSPPGISGQTTVATLPQTAPTPKRTQRKLLRTLGKVPLRVILIVPFVVQVVGA
VGLVGYLSFKNGQKVVNDLANQLRSEVSARVHDRIQTYVEVPQQVNQFNAHAIQLGLLDF
QNVRKAELYFWRQVQTYESIGNAGFANEQGQFLRVGWINRLSTTEQPQIAEQLTPGGGTL
RYYNIDPEGNRLNVAKTVLNYDTRTRPYYTAAVKQGKPTWSEVYINTGYDLLQIKASRPF
YDRKGELLGVLACELGIDQIGKFLQTLKIGRSGEVFIMEPSGELVASSISAQPLLVGRSK
NAKRLRALESNDLLMRSSAAFLRDRFGHLKNIQKNYQLEFKLNNQRQFLQVSSFRDGYGL
DWLIVVVVPESDFMQQIHANNRITFFLCIVTLMAAILIGILTVRWVTEPLIRLNFAAKDI
AKGEWDKAVELDRSDEVGQLAQSFNDMAGQLKESFEILENHKNAFARFFPLEYLKFLQKQ
YVTHVHLGDHVSKEMAVMFSDIRSFTTLSESMTPQDTFSFVNAYLQRVGPAIRNHNGIIV
KYLGDGLMAIFPNGADDAVRAGIAKLKRIRDYNQHRQARGYQLIQAGIGIHLGYILVGMV
GEENRMQGDALSDSVNLTARLEGLTKFYGVSMLISEQVLERLNDPSQYEIRFLDRAIVKG
KTESISIYEVMDGEPEEVKALKFQTQSDFEQGLEYYRRREFAEAKRYFEQVLAVNLSDKT
AQLYLERVHQLMEEGVPENWDGVWTFDQK
Download sequence
Identical sequences K9WFY1
WP_015183471.1.75295 gi|428311759|ref|YP_007122736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]