SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311845|ref|YP_007122822.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311845|ref|YP_007122822.1|
Domain Number 1 Region: 201-372
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-42
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 12-145
Classification Level Classification E-value
Superfamily CheY-like 8.11e-41
Family CheY-related 0.00038
Further Details:      
 
Domain Number 3 Region: 130-213
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311845|ref|YP_007122822.1|
Sequence length 376
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MNPSVVSHSSKADHILVVDDSPDNLFLVQTILEEEGYAITLAEDGRTALKQIELSPPDLV
LLDVMMPGMDGYEVTKRIRENQQSPFMPILLITAFEGPSVVRGLDTGADDFIRKPVEVDE
LLARVRSLLRLKHAIDEREQIARQREEFVSWMAHDLRTPIVAAERMLMLFQQGALGELSP
GMEEAIVTMARSNRNLLAMVNTLLEVYRYEAGRKTLCFSPVEIKTVIEEVIQELSPLAEQ
KQLSLKPNFGEKVNTKVVGDRLELHRVFTNLIGNAIKFTDTGSIEVRLSNSPDPNDPKTS
WLLIEVEDTGPGIALDDQKMVFERFRQGSHKRSGSGLGLHLSRRIVETHQGTLDLQSELG
KGSVFRVCLPTQQPKN
Download sequence
Identical sequences K9WHX7
gi|428311845|ref|YP_007122822.1| WP_015183557.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]