SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311851|ref|YP_007122828.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311851|ref|YP_007122828.1|
Domain Number 1 Region: 276-357,393-455
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.14e-31
Family Histidine kinase 0.0073
Further Details:      
 
Domain Number 2 Region: 166-240
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000608
Family Homodimeric domain of signal transducing histidine kinase 0.0034
Further Details:      
 
Domain Number 3 Region: 114-173
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000243
Family GAF domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311851|ref|YP_007122828.1|
Sequence length 488
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MFIPASSEFVTLCKSQVAVLTQGLGAALSAVYLTEELIEGNQPKLIPVVIYPETTGVWEE
NHPELVLPELGGKMTTIPRLSQAVPKLLPQVSDYDQTVDSTSPDRADNFLQRQRQVVLPL
IHEGVVMGLLVTSREDRPWNEKELATIERIARTLSIAYIMDQRRAWFEQQLTQASRLKAQ
QRDRLDDLLHQLRNPLTALRTFGKLLFKRLLPGDRNRDLASSILRESDRLQELLKEFDTY
LNTNETEQPPLLLPAAVQPEASPRLGTGNWCRVTGEESSPSIIPISITAVLEPLIDTAKA
IAQERNLFLCSQIPSNLPLVRGNPKGLREVLSNLIDNALKYTPAGGKIDIRVDVLAQTPH
RQTWGISTDENLSPREDGVTQSIHTGITQPEQRLAIMISDTGPGIPPQDLEHLFERHYRG
VQAATAIPGSGLGLAIAKELIEQMQGEIEVYSPAQQVWATQSWESQSQGQNQPARGTTFV
VWLSIANK
Download sequence
Identical sequences K9WIQ9
gi|428311851|ref|YP_007122828.1| WP_015183563.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]