SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311863|ref|YP_007122840.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311863|ref|YP_007122840.1|
Domain Number 1 Region: 479-642
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-43
Family Histidine kinase 0.00061
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily CheY-like 6.12e-27
Family CheY-related 0.0017
Further Details:      
 
Domain Number 3 Region: 275-398
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-24
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 4 Region: 406-490
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Domain Number 5 Region: 121-235
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000685
Family Heme-binding PAS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311863|ref|YP_007122840.1|
Sequence length 655
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MFRLLLIDDSPDDRVLIRRELSQEFPHLEIEEITEAKSLSQALSAGNFDLVITDYQLRWN
DGLTVLQEIKSRYPDCPVIMFTDSGSQEVAVEAMKAGLDDYLIKSPKHYVRLSNAVRLAW
QRRESQRKAERLQMRLQALLNRLNVGVFRSTLQGQLLEGNASFLRLLGVSSLEEARTLDL
QALLRLPEGELQQGNSEHEIHFCRADGRLIWLCLNQSLNTTEGEPILEGLIEDITERKLV
QEELKRAKDELENRVIERTQELRQINAQLLKEMQEREQVQQRVHESEERYRHLVELSPDA
IIINSGGQFVFINSVAVKLFGATSPSDLIGKPILDRVHPDYRQIVQEQIRQILEQGKPVE
LMEQKFLSFDGTVIDVEVAAAPFIYQQQPAVQVVVRDIRTRKKAEEELRKMLEKERELSE
LKSRIITTISHEYRTPLTIILTSAEFLEKYSHKITEERRLLHLKRIQTSSKHLADLVSDV
LFMGQAEADRLKFNPIVLNLEVFCREVLEEIRFSIDNQAVIIFVVKGNCTQACLDEKQLR
QILINLLSNAIKYSPKGGTIQFNLECQENVAVFRIQDEGIGIPTEDVSQLFESFHRASNV
ETIPGTGLGLAIVKKCVDSHQGKITVNSVVDGGTTFTVTLPLKPPVSHFDLRSSR
Download sequence
Identical sequences K9WI25
gi|428311863|ref|YP_007122840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]