SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311886|ref|YP_007122863.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311886|ref|YP_007122863.1|
Domain Number 1 Region: 25-469
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.9e-132
Family Amylase, catalytic domain 0.00000177
Further Details:      
 
Domain Number 2 Region: 469-549
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.4e-19
Family alpha-Amylases, C-terminal beta-sheet domain 0.0064
Further Details:      
 
Domain Number 3 Region: 757-818,868-1109
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000224
Family APH phosphotransferases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311886|ref|YP_007122863.1|
Sequence length 1136
Comment trehalose synthase [Microcoleus sp. PCC 7113]
Sequence
MQTDHSILKDDPLWFKNAIIYEVPVRAFADSNGDGIGDFRGLTEKLDYLQDLGVTALWVL
PFFPSPLRDDGYDIADYTSVNPIYGTLDDFKEFLDAAHQRGIRVIIELIINHTSDQHPWF
QRARRAPKDSVERDFYVWSDTPEKYQEARIIFQDFETSNWAWDPIAKAYYWHRFYSHQPD
LNYDNPAVRQAVFEVLDFWLEMGVDGLRMDAVPYLYEREGTNCENLPETHAFLKQMRKHV
DEKFPNRMLLAEANQWPEDAVQYYGAGDECHMNFHFPLMPRLFMSLRMEDSFPISDILQQ
TPAIPDNCQWGLFLRNHDELTLEMVSDEDRDYMYRVYAQDPETRLNLGIRRRLAPLLGND
RRQIELLNSLLLSLPGTPVLYYGDEIGMGDNIYVGDRNGVRTPMQWSSDRNAGFSRANPH
KLYLPVIVESEYHYEALNVEAQRGNPNSLWYWMKRLIATRKRFQALGKGSFEFLHPENRK
VLAFTRTYQDEHILVIANLSRFVQTVELDLSPFKGTVPVEIFGRTEFPPVGESPYFLSVS
PYSFYWFTLKLQPSSLQSSKPQSTLPTLVANGKWQSVFSQLQSKATLESTLPDYLYTCRW
FGGKARTVQSANITEMIPVSYKDMEAQMVWLRVDYIQGDPETYLLLLAYAEGEQGMHLLA
EKPQSIVAYLQIPGNEETGVLFDAVADKNFLIFPLEAIAHHQRYKGMAGELVTMSTDLFP
QLYKDGSNIDPSLIKGEQSNTSIIYGVSEAGRESVPRFILKLFRKVEEGINPDLEIGRFL
TEKKLLEHFASIAGALEYRRPRAETMTVGILQEFILDTRSSWEYTLDSLRTYFEHVSIQQ
AEITEVPVPSGSLLDLQASEIPELASLTIGSYLASAQLLGQRTAELHIALASNTDDPDFT
PEPFSSFYQRSIYQYARNLTGQVLLLLKNRLKQLPPNTQRLAQAVLNASDQIMGRFQLVL
DQKITAMRTRTHGDYHLGQVLYTGKDFIIIDFEGEPARSLGERRMKRSPLRDVAGMLQSF
NYAVTQALRNEVESGMIRPENLPLMEQWAQFWFCWVSSAFLKSYVEVASQDSFLPKSRAE
LEVLLDSYLLEKVIYELGYELNNRPDWVEIPLQRLLQLQELTTSGKYSQSEALKES
Download sequence
Identical sequences K9WIV1
gi|428311886|ref|YP_007122863.1| WP_015183598.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]