SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311911|ref|YP_007122888.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311911|ref|YP_007122888.1|
Domain Number 1 Region: 968-1162
Classification Level Classification E-value
Superfamily GAF domain-like 1.64e-35
Family GAF domain 0.00035
Further Details:      
 
Domain Number 2 Region: 579-766
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-34
Family GAF domain 0.00027
Further Details:      
 
Domain Number 3 Region: 791-969
Classification Level Classification E-value
Superfamily GAF domain-like 2.8e-24
Family GAF domain 0.00041
Further Details:      
 
Domain Number 4 Region: 40-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-16
Family Extended AAA-ATPase domain 0.064
Further Details:      
 
Domain Number 5 Region: 408-569
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000863
Family GAF domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311911|ref|YP_007122888.1|
Sequence length 1168
Comment GAF domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIEDSVFSTQQRIPSKTLNPDYHYKVGGHLPLNAPTYVVRQADFDLYEGLKAGEFCYVLN
SRQMGKTSLRVRTMQKLQAEGFACAAIDLTKIGSQDITSDKWYNGVIRSLVRGFNLSDKV
NDRTWLRDREYLPPVQRLSEFIEQVLLPSVSQKIVIFIDEIDNTLSLNFKTDDFFAFIRA
CIEYERLTFALLGVATPSDLIQNKIRTPFNLGRAIELQGFELEEAQPLAEGLAIKSHYPQ
AVLKAVLDWTGGQPFLTQKLCHFIFISESPIPIGGEKIWVENLVRSRIIDNWEAMDEPPH
LKTIRDRLLRIGQRSRALLDLYQQILEHGEIAATGSPEHLELRLSGLVVKRDGKLRVCNR
IYASVFNLSLVKKALVDLHAEFMQLVTKQEQRLLSMLSMMKGKGFDELLHDILGSITLKI
CELVSVDRTTILFVDEDQKELWSIIAREGSSRYPEIEILASKETEGRVINFKKLVSTPFN
FCEDTESRDDKRGTANGYHTYNELLLPILNEQGDLVAAVQLLNKLKPINNPAAPLSERVD
KLGFTTADQKQFEDYAPSIRRVLERCQDCYKLTQKLHAAEALTKATRYLSESLDSDEILG
RVMDAAKKLMNADRSTLWLIAHETNELWTRILFEDGSVRELRIQVGQGYAGKVAATGEPL
NIAFDLYDHPDCETAKKTDQQTGYRTCSLLCMPVFSPDGELLGVTQLVNKKKPGEFPDYD
PADWPKAPECFKASFDANSQKYMEIFNAQAGVALQNAKKFERAKEEVKTHKENVVSQTLS
MLSKVMENEGFDDVLDATLRSMTIKMGKSLRADRTAIFLLDQEKNELWSILAEEDDEGER
SLEIRIPADKGIVGEVASCKQLVNIPFDFYDDSRSATAKEQDRKNGYRTYTMLALPLLNE
QGDLVAVVQLLNKLKPGYHRTASLAEKVDQQGFTKADEQKFAEDAPLIQMILESFRSYHK
TTRAQRVAAALMAATRSVSQSSLELNEILQRVMEAAKKLMNADRSTLWLIDYKTGELWTN
IPFEDGSDKELRVQIGEGYAGKVAESGKPLNIPFDLYGRPDSGTARKTDQKSGYRTYSLL
CMPVFSPDGDLIGVTQLVNKKKPGEFPDYDPITNGIEAPEHFRMSFDESDEKYMQIFNNQ
AGVILQNAELLAEVKRQEQTLRNNLSQP
Download sequence
Identical sequences K9WIX9
gi|428311911|ref|YP_007122888.1| WP_015183623.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]