SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312019|ref|YP_007122996.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312019|ref|YP_007122996.1|
Domain Number 1 Region: 2-66,104-178
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.14e-36
Family N-terminal domain of MutM-like DNA repair proteins 0.001
Further Details:      
 
Domain Number 2 Region: 173-262
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.05e-29
Family Middle domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 262-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000285
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312019|ref|YP_007122996.1|
Sequence length 319
Comment formamidopyrimidine-DNA glycosylase Fpg [Microcoleus sp. PCC 7113]
Sequence
MPELPEVETVCQGLNQMTLNQEIWGGDVLLTRTIAYPFSMGEFLAHLKNVAITRWHRRGK
YLLAQLAHSDSKYQTGVMSQESMPQIHLRENLPKSNSPNLQSSDGGWLGVHLRMTGQLLW
LNREQPLHKHTRVRLFFPNNQELRFVDQRTFGKMWWVPPSVPLESIITGLKQLGPEPFSE
QFSLEYLAGKLRHRQRSIKAALLDQTLVAGVGNIYADEALFLSGIRPDTLCADLNPEQIE
RIRSSLIQVLQASIQVGGTTFSNFLNVQGVNGNYGGVAWVYGRTGELCRVCHRSIVRLKV
AGRSSHFCPNCQQLPTAKR
Download sequence
Identical sequences K9WGT4
WP_015183729.1.75295 gi|428312019|ref|YP_007122996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]