SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312032|ref|YP_007123009.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312032|ref|YP_007123009.1|
Domain Number 1 Region: 3-378
Classification Level Classification E-value
Superfamily Citrate synthase 3.14e-141
Family Citrate synthase 0.0000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312032|ref|YP_007123009.1|
Sequence length 378
Comment 2-methylcitrate synthase/citrate synthase II [Microcoleus sp. PCC 7113]
Sequence
MTVCEYRPGLEGIPVAQSSISYVDGQKGILEYRGIRIEELASHSTFLETSYLLIWGELPT
KEELEAFEYEIRHRRRIKYRIRDMMKCFPETGHPMDALQASAAALGLFYSKRALDNPDYI
REAVVRLLAKIPTMVAAFKQMRKGNDSVQPNDDLDYSANFLYMLNERKPDPLAARIFDIC
LTLHAEHTMNASTFSAMVTASTLTDPYAVVASAVGTLAGPLHGGANEEVITMLEEIGSVE
NVRSYLEDCVQRKSKIMGFGHRVYKVKDPRATILQNLAEQLFEKFGHDEYYEIAVELEKA
VEEKLGQKGIYANVDFYSGLVYRKLGIPTDLFTPIFAIARVAGWLAHWKEQLEENRIFRP
TQIYTGVHSVDYLPIEKR
Download sequence
Identical sequences K9WHF5
WP_015183742.1.75295 gi|428312032|ref|YP_007123009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]