SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312038|ref|YP_007123015.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312038|ref|YP_007123015.1|
Domain Number 1 Region: 669-763,792-864
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.23e-38
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 888-1014
Classification Level Classification E-value
Superfamily CheY-like 1.99e-37
Family CheY-related 0.0056
Further Details:      
 
Domain Number 3 Region: 466-591
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.02e-28
Family Heme-binding PAS domain 0.03
Further Details:      
 
Domain Number 4 Region: 600-681
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.18e-22
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 5 Region: 175-341
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-22
Family GAF domain 0.0091
Further Details:      
 
Domain Number 6 Region: 47-172
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000314
Family Heme-binding PAS domain 0.072
Further Details:      
 
Domain Number 7 Region: 364-478
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000158
Family Heme-binding PAS domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312038|ref|YP_007123015.1|
Sequence length 1138
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MVRFGLRLTDTGGKIETQSQKLTQNNSHLEQPMKIDHRADENMALNQQLKEALVESERRF
RAIFDHTFQFTWLLKTDGTLVEANQRALDFRGQKRSDVVNHPFWEAPWWSHFPTIQEQLK
LGIAAAAQGEFVRYEVDITGAFEAVMTLDFSIKPFTDDTGQVVLLIAEGCDISDRKQVEA
LLAEQNHILEMIAKGEPLPDVLSIIAQMIEQQIPQCWCSFLLLDKNGVTLRHGAAPSLPD
AYNEAIDGLTIGPYAASCGTAAYWGEAVIVEDIESHSVWADFRDLALSYGLRACWSRPIC
STVGKVLGTISIYYREPHTPNRYEQELTAKATQLARIAIERSFAQEELLRSNAMLKAQQE
AALDGILVIDENRQIASYNQRFCQLWQIPPQLAETGDEGRLLNEMLSQLQNPQQFLAEAE
YLYAHPTETSYAEVTLIDGRIFEFYSAPVLSPTGGYYGRIWYNRDITERKQAEAALRQTE
EKYRLLVESAGDAIIAVDAETGIILEANQMAETLLGRTRFELIGLHQSEIQPPERREKYT
TLFKKHVEVSGVLQSEVELFHKDGTIVPVEVSATVVDVQGKKIVQGIFRDIRDRKQTEKI
LKQAKVAAEAANRAKSEFLANMSHELRTPLNGILGYTQILKREPNLNVKQQEQLGIIQQC
GEHLLTLLNDILDLSKIEARKMELYLSDFEFPHFLDSIIEIVRIHAEQKNIFFRYEMLSQ
IPAFVRGDEKRLRQVLINLLGNAVKFTDAGGVTFKVGYVMETEELGQGGFSSGHLSGDTP
LSHPASPSPITKMRFLIEDTGIGMPSEQIAEIFLPFHQIGDPTRQAEGTGLGLAISQKLV
QLMGGKLHVESRLGQGSVFCLDLDLPIASEEADVAEHHEGRVIRLKEKYRLLVVDDKWEN
RSVLVDLLSPLGFEVLEARNGQEGLNQALQHKPDVILLDMVMPGMDGFEVVKQLRELPNL
ERVVVIAMSASAFDNDQEKSLTAGCDGFISKPVQVGKLLGQLRHHLGLEWVYEETDLDTL
TVPDGATAPIAPSPKVAIRDERNHALQTGLPLQGSPLPATHYAHAWQTLTVVPPPEELQA
LYELAMMGDIRGIQQQAKRLEQLNEQFAPFAKQLSQLAKGFQEKQILEFVRKYMAEDE
Download sequence
Identical sequences K9WIM5
WP_015183748.1.75295 gi|428312038|ref|YP_007123015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]