SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312046|ref|YP_007123023.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312046|ref|YP_007123023.1|
Domain Number 1 Region: 635-811
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 113-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0028
Further Details:      
 
Domain Number 3 Region: 504-643
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.83e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0054
Further Details:      
 
Domain Number 4 Region: 4-137
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.91e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312046|ref|YP_007123023.1|
Sequence length 845
Comment NAD(P)H-dependent nitrite reductase, large subunit [Microcoleus sp. PCC 7113]
Sequence
MTAKKNLIVIGNGMVGHKFLELMIAKGQTQEWNLITFCEEPRVAYDRVNLSGYFSGKTAA
DLSLVEPGLYQENGIQIHIGDKAVAIDREQKTVSSANGLTVPYDKIVLATGSSPFVPPIK
GNEISGAFVYRTIEDLEEISTYAKNCQVGVVIGGGLLGLEAANALKTMGLKTHVVEFASR
LMPVQVDDAGGAILRSKIEALGVSVHTSKSTTQIVSEDGKIVKMLFADGSELETDMIVFS
TGIRPRDELARSCGLEVGERGGIVINDYCQTSDPEIYAIGECALYKNRIYGLVAPGYTMA
GVVADLLNNVTTSTFIGADMSTKLKLLGVDVASFGDAFARTPGAREIAITDTVQGIYKKL
VLNEDGTRLLGGILVGDASAYGTLLQFVQNAITLPPHPEDLLMPPREGAPVAKMGVESLP
DTAQICSCNNVSKGQICTAIREQNLTDVPTIKKCTKAGTGCGGCVPLVTDLLKSEMKKAG
IEVKNHLCEHFAYSRQELYHLVRVHQIKTFDELIQQHGTGRGCEICKPAVASILASTWNE
HILEKSLVGLQDTNDYYLANIQRDGTYSVVPRVPGGEITPDKLIVLGQVAQEFGLYTKIT
GGQRIDLFGARVEQLPHIWQRLVDAGFESGHAYGKALRTVKSCVGSTWCRFGVQDSTSLA
IEVELRYRGLRSPHKLKSAVSGCTRECAEAQSKDFGIIATEKGWNLYVCGNGGMKPQHAI
LLAEDIDKETLIKYLDRFLMFYIRTADRLERTATWFNKLEGGIDYLKQVIIHDSLGIGAE
LEQEMQYLVNTYQCEWKTTIEDAEKLNRFRHFVNSDESDPNIVHVEERGQKRPAKEHEKT
LAITS
Download sequence
Identical sequences K9WJD5
gi|428312046|ref|YP_007123023.1| WP_015183756.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]