SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312073|ref|YP_007123050.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312073|ref|YP_007123050.1|
Domain Number 1 Region: 33-346
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.1e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.0046
Further Details:      
 
Domain Number 2 Region: 872-948
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000549
Family Filamentous hemagglutinin FhaB, secretion domain 0.042
Further Details:      
 
Weak hits

Sequence:  gi|428312073|ref|YP_007123050.1|
Domain Number - Region: 1006-1122
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000126
Family Filamentous hemagglutinin FhaB, secretion domain 0.035
Further Details:      
 
Domain Number - Region: 700-858
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.031
Further Details:      
 
Domain Number - Region: 1348-1441
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0022
Family Filamentous hemagglutinin FhaB, secretion domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312073|ref|YP_007123050.1|
Sequence length 1826
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSVNRIWKGGLCRKGLQWTTGALGLLPIGLAVFSVPVFAQIVPDNTLGNESSLVTPNVNI
RGLPAERIDGGAVRGSALFHSFSEFNVNNGQRVYFSNPAGIADIFSRVTGSNVSNILGTL
GVDGGANLFVLNPNGILFGPNAQLDIGGSFLATTGSSFKFSDGSEFSATQPQAAPLLSIN
VTPGVQWGASQPGATITNRGNLRAGQDLTLAAGNLDVQGQLQAGRDLTLQAQDTVKVRDS
VTNPFIASAGGKLEVQGNQGVDIFALNHPDSGLFSGGDMVLRSGNTVGGDAHYWSGGNFR
IETLDGNLGNLFSPNDPVIRASGDVNFGGYTGASLHILAGGSVTITRSVEIRRADPINGL
VEDVTLSDGTPVKINGRTQPTLDIRAGTTAFGTPGTIGTSTATSANITLGTITNNGGMVF
LTNQYQPNLALAGGNINVNGDINAFTGVFSSEKNGGSITIDARGNISTASLYSSTSEEGN
GGAIALIAGGNISTQKLSSASNYLSIPDYSGGNGGALSLKAGGYISTGELDAYSLGGNGG
AITLDAGGYIKINGDIFTESPNSGDIGGGAITLTAGGEIITGNLSSVSSRLLSKDIGTGG
AITISTTSGNISLGKVNSFSYSQYGNSGAGGAIDISTTNGNISLKGDLNSFSYSKFGSSG
TGGEISLSVRNGNIVGERFTADDSRQRFPLLNSFSVSEQGTAGNGGKVTLEAKNNVSNLE
ILTLSSSSEAGAVDVKGFGNLSLTDTNIITSKPLTLTIPGNPSETITLDVGKTGRSGDVA
ITSLGNLTFNNSRILSDTKGSSPAGNVNITSPGLITFNNSQVISNTTNTGQAGSITVKAP
ELRLDSSSRLSAETSSSGRAGDLTLRPYDSGQTLSVLLQEGAKISASTTDIGKGGNITIT
APESVTLSGKGSISATTSSNGQAGSVTITTPTLAIDGTQISTSTSGRGKGGDLNITAPNS
VTLSGDGRLSAETTGSGQAGSVNITTPTLNINTGAKVSTTTTQPATGTGGDITVSTNTLN
LSGADSSLLAETQGVANAGNLTLNPYSGNDLQVNFAEGAKVSASTFGSGQGGSLNVTAPN
SVTLRGDGQLSAEATNGGNAGGVTINTQQLSIEQGAQVAASSKNGSGTAGDVNITASTVT
LNDGKVTAETDAGGSAKPANITLRNLNTLNLSNNSSISASTQTGQAGSINLNQGANPAAL
VTLNNSRISAQADGERGNAGGVTLNTSQLSLENGAKISASNISGTSQDITLQGLNTLQLR
DRSEISASTQTGKGGSVSVNAQGGNVALTGNSHIQSEAKGGQAGNLDITANQLTLRDGSS
ATVSSTGGGTAGKLAVSAPEVILEYSAKLAATTQAGSGGDIQLQNLSSLQLRNSSEISAS
TQTGKGGSVSVNAQGGTVALTGGSHIQSEAKGGQAGNLDITANQLTLRDGSSATVSSTGG
GTAGKLAVSAPEVILEYSAKLAATTQAGSGGDIQLQNLSSLQLSNNSEISASTQSGKGGN
VSVNAQGGTVALTDKSSLKAEATNGGQAGNLQITANQLRLREGSQATVSSPQGQAGNLSI
TANNLSLDRGQITAETGQRSDKGGANINLQVTDLLLLRHQSLISANATGDANGGNITIKA
PFVVAVPSENNDIIANAFSGDGGQINIIDNYRVFGLKPQNRQSFDTLRQNRTSDISASSQ
SGNQGNINIQSLSIDPSQGLTQLPVEVIDSSQQIANRCGPGNSKSANGQGEFVVTGRGGL
PPSPDDMQRSGAIPPSWVTRDGGNISRSAAPVAPPATPATPPLVEAQGMFINAKGEVVLT
AQTPTATPHQPGISEPLCSPATKGNE
Download sequence
Identical sequences K9WIQ1
gi|428312073|ref|YP_007123050.1| WP_015183783.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]