SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312107|ref|YP_007123084.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312107|ref|YP_007123084.1|
Domain Number 1 Region: 568-697
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-21
Family Heme-binding PAS domain 0.038
Further Details:      
 
Domain Number 2 Region: 451-569
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000145
Family Flavin-binding PAS domain 0.074
Further Details:      
 
Domain Number 3 Region: 391-441
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000327
Family HAMP domain 0.0058
Further Details:      
 
Domain Number 4 Region: 165-249
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000216
Family Sensory domain of two-component sensor kinase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312107|ref|YP_007123084.1|
Sequence length 751
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSSQLLNPSSPLTSSQKNLNWLTSKLPKKFRLRAVLVVPFIIPIFVSTGLVGWLSFRNGQ
RAIDDLATQLNSEISNRIQQHVLSYLNKSHQVLQITNAGIQSDNLKLNNFAALQRYFWRI
VQNGETETYLSFGNEQGEFVGVEHLENGRFQLKIRTQEIAPKRDVYFLDDQGNRAILANR
AEYDPRQRPWYQAAKQTGKPTWSPIYPFFSRKNTSLGISSVMPIFESTDKLLGVLCINVT
LTRITEFLENLRISPHGQSFVLERSGDLVVSSKIQQPFLVKGEGDNREIERIKAISSNNS
TVRATTQHLVERFGNLSAINSSQNFKFKMEGAWQYVQVLPCQDERGIDWLIVVVVPESDF
MGQINANTRTTILLCLVTLVVATTIGILTARWISQQILKLNNASQEIARGDLNQNIEVNG
IIEIENLSASFNSMAHQLQESFDSLEAKNADLEQAKEALAQAKEQLEAVLNAVPGSISWV
DSNGLYLGVNRHLAESLNLTPDSIVGKEIGFFKNSSQYAEFMHQFLASAESSSSQEILVN
VNGSVRYYLMAVQKYQQGTATVSVGIDVTKRRQAQEALRIAEENYRSIFENALEGIFQST
SDGHYISINPAMARLHGYDSPDDMMVSVTEIGRQLYVDPSCRSEFKRLMQEKGEVNSFVY
QVYRKDSSIIWVEENTRAVRDTYGNVLYYEGIIQDISKRKQEEDALKRQLQELRIEIDQQ
KRKQDVAEITQSDYFQELQAAVERLRFDEDW
Download sequence
Identical sequences K9WHM3
gi|428312107|ref|YP_007123084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]