SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312118|ref|YP_007123095.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312118|ref|YP_007123095.1|
Domain Number 1 Region: 458-626
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-48
Family Histidine kinase 0.00068
Further Details:      
 
Domain Number 2 Region: 7-140
Classification Level Classification E-value
Superfamily CheY-like 9.96e-36
Family CheY-related 0.00069
Further Details:      
 
Domain Number 3 Region: 655-777
Classification Level Classification E-value
Superfamily CheY-like 8.25e-31
Family CheY-related 0.0055
Further Details:      
 
Domain Number 4 Region: 244-371
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.26e-29
Family Heme-binding PAS domain 0.078
Further Details:      
 
Domain Number 5 Region: 390-469
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.94e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 6 Region: 150-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000995
Family Heme-binding PAS domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312118|ref|YP_007123095.1|
Sequence length 779
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MFEQQLIKILHVDDNEANRYAVNRMLKRVGFNVIEAATGEAALELVDQARPDLIILDVKL
PDLNGFEVCRRLKANPATAFIPVLHLSASFIESRDKAQGLDSGADGYLAQPVEPIELIAT
VRALLRIRQAEESALTLAQEWQSTFDAMSDGVCLLNEEGRVMRCNSAMTELLHKPFSEII
RCLHQELMPSTLGVVEASPFTLVQETRQRESREVQCGSHWFAVTVDPIFNQGGTFIGAVY
ILADITDRKQAEEALRVSEERFRLLLENVTDYAIFFLDTQARVIRWSLGAERILGYQEPE
ILGKPSSIIFTPEDIEQGADQQELEIAVTEGRAENERWHIRKDGSWFWGSGIVTPLRNEQ
GQIRGFSKIMRDFTERKRAEDERNQLLAREQEARAAAEAANRLKDEFLATLSHELRSPLN
AMLGWTRLLNSRQFDAATTARALQTIERSAKSQAQLVEDLLDVSRIIQGKLRLNTRPVEL
VSVIEAAIETVRPAAQAKEIGLQCVLDPATGPVAGDSDRLQQVIWNLVSNAIKFTPKEGC
VQVQLERVNSHVEITVKDTGKGIDPEFVPYVFERFRQADSSSTRVYSGLGLGLAIVRHLV
ELHGGTVRAHSEGEDKGATFTVKLPRISVVEPSSGEHSPRTVALAAPCDNSPALNGVRVL
IVDDEMDSREFLVAALEQCEAKVFAFASAGEALAAISQLKPDVLVSDIAMPLEDGYSLIR
KVRQLSAEQGGQIPAIALTAYARAEDRTRAISSGFQMHISKPVEPAELATVVASLAKHG
Download sequence
Identical sequences K9WIT9
WP_015183826.1.75295 gi|428312118|ref|YP_007123095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]