SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312138|ref|YP_007123115.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312138|ref|YP_007123115.1|
Domain Number 1 Region: 764-948
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-39
Family Histidine kinase 0.0000112
Further Details:      
 
Domain Number 2 Region: 1134-1262
Classification Level Classification E-value
Superfamily CheY-like 9.11e-34
Family CheY-related 0.0007
Further Details:      
 
Domain Number 3 Region: 44-165
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.96e-25
Family Chemotaxis protein CheA P1 domain 0.0052
Further Details:      
 
Domain Number 4 Region: 949-1094
Classification Level Classification E-value
Superfamily CheW-like 8.63e-23
Family CheW-like 0.001
Further Details:      
 
Domain Number 5 Region: 610-665
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000432
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312138|ref|YP_007123115.1|
Sequence length 1270
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MGNWENYPLSSWHSFFPNYQCPITNAQLPIPHHETMALNPEIRDQAYQFFIEEAPELLQA
IESGLLTLKQEKNTSHVHNLMRFAHSIKGGAASVELEAIATLAHRLENIFKVLYSDELHV
DTDLESQLLQAYDCLRLPLMEQIQTGYFDPSQAFDLAEPIFAQLEERFSEQLSQADTYMP
SSADLGVDMTQSIFEVDVAQGVERLTVVVANPQNYEVAGELRAQAEVFAGFAEFLNLPDF
GAIAHTTLAALKAHPDRALEITQLALVDFQMARVAVLAGRNSSTRSCVEIKPSPALIALA
NTATPITESIVELEPSFEPVEDDIFSLFDLSVAPAEDSMSSLFEPSLEAAEDNLFSSFEL
SVEPSKEVTKEITRSIIEPNIEPSEDNISSLFESNIEPIEDNISSLFEANIEPNEETISS
LFELTHAEIEDPIPSLEDIFGGAMATPDIAGEQCLSFGEDGERENKSAAFDSKLVSDSEI
LEVEWAQAIGITDEAEAGIPALEQGFGDAFIPVEIEAPTSSAIVPVTSSFDALQAQTSEE
IELSSTPETLEVAIHQIEQIFESLPELAESSIEVIANSLTPNSKVNIQDSTTVNSPTGAK
SEAAPTPNLSVRVDVERLGRMNNLVGELAINRNGLSLQNEQLQGSVRELLNRFSRVQNLV
GQLQNLSDKMLIAPERHNLGSLPRILDPLGTFKVAQSNFDDFDSLELDNYGVVHSELQGL
LEEMMQLEESVDDIVLFAKATDQTLERQRQMLTQLRDELMWARMLPLGEVLNRFPRMLRD
LSTTYHKPISLKLSGTGVLVDKAVLEKLFDPLLHLIRNAFDHGIESRDIRRSLRKPEQGQ
IEIKAYHRGSQTVIEVKDDGQGLNLERISRRAVELGLVSVEQLAMIPTSRLFNLIFEPGF
STASEVSELSGRGVGLDVVRSQLRSLKGTIGVSSETGVGTTFSLRLPLTLTIAKLLVCFS
GSTALALPSDSIEEIVIPKPEQIKYSGSQQFLHWRGEIVPTYRLTELLEYACPLPDTSPS
RALLAVPTPESWASPMLVLRQENTFLALEVDRLVTEQELVIKPFGSAIAPPSSTYGCTIL
GDGSVIPVIDATVLLDQLLAQSAAATATTTGLNPQAMLMESAAPGSASFSNSLPHSTPMK
TPTVLVVDDAVALRRTLALSLERAGIRVLQARDGREAIERLQQSSSVELVICDIEMPNMN
GFEFLSHRRQDPQISTIPVVMLTSRSNDKHRWLAMQLGANAYFTKPYLEQEFLVAIKQLM
GQPTVERIPV
Download sequence
Identical sequences K9WIV7
gi|428312138|ref|YP_007123115.1| WP_015183845.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]