SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312139|ref|YP_007123116.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312139|ref|YP_007123116.1|
Domain Number 1 Region: 646-946
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 9.29e-68
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 436-606
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-39
Family GAF domain 0.001
Further Details:      
 
Domain Number 3 Region: 381-429
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000106
Family HAMP domain 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|428312139|ref|YP_007123116.1|
Domain Number - Region: 115-243
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000133
Family Sensory domain of two-component sensor kinase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312139|ref|YP_007123116.1|
Sequence length 947
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MTQISPNSSKNDTNGNGRMPSSKTLQLEGGTAGNHALPVHNTGISEPGLLIPKAPFSDRK
RHGFQWSSLRTKAAILAISLGTIPVLVTGGIGYYFANRGFTEQIATVKLDRAAGLEDKLK
RFMRERYGDIQVISRRNFLTKAEFRDKISVEEKEASLDEIVENYKTYDLISVSDLKGNVI
LKSKSDPLPNQSDREYFQDVLKTDKPVITSAIIPRVSANPERPAINIAAPVKDSVTGKTI
AIVRARLPVESLDELSKNFAASGDEYYVIDTAINKIFLGSQKSKEFKEPLPIFPGLSKLQ
AADKPNTLIFNDQAEKVEKLFGFTKFTKLEGLPDLPWQVIIAQPTRLAFEPQRQLLLAVS
LGTLITAVLVSAIAIFVTNRTVRPILSAAGAVDKIGQGELETRLEIQGEDEIAELGSNIN
VMAEQLQTFVQEQTLAAERAFLLTKVTGSRALSSQELNNLFGEVVDDARKSLNVDRIVIY
RFNPNGDGEIVSESVARGWPSALITKIDHSFVSEQQLEAYIEGSIQPINNILNANLAPEQ
LRVMERLEIRASVEVPILNEGRPYALLMAHHCETAHTWQSSEINFLQQLAAQMGLSLDRV
LLLEQTEQLAQEQRQLKEGLQRRALDLLQEVDPISKGDLTIRAKVTADEIGTIADSYNAT
VGNLRKIVLQVQQAASQVAQTTSSNEASIQSLSTEALRQAEEIALALDRAQEMAQSVQLV
AGNAEEALAAVVEASQTVEEGDQAMNRTVDGILAIRETVAETAKKVKHLGESSQKISTVV
NLISTFAAQTNLLALNASIEAARAGEEGRGFAVVADEVRSLARQSAEATSEIEKLVAAIQ
GETNEVVAAMEAGTEQVVMGTKLVDETRQSLNKITTVSSKISDLVASITQATVVQSQASQ
AVTQTMTNVAAIAEKTSQEATFVSSSFEQLLKVAKALETEVGQFKVG
Download sequence
Identical sequences K9WH22
gi|428312139|ref|YP_007123116.1| WP_015183846.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]