SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312174|ref|YP_007123151.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312174|ref|YP_007123151.1|
Domain Number 1 Region: 12-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-54
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 1701-1883
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-52
Family Adenylyl and guanylyl cyclase catalytic domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1365-1542
Classification Level Classification E-value
Superfamily GAF domain-like 1.55e-26
Family GAF domain 0.0049
Further Details:      
 
Domain Number 4 Region: 299-317,344-614
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.34e-16
Family RecA protein-like (ATPase-domain) 0.052
Further Details:      
 
Domain Number 5 Region: 1526-1654
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000134
Family Heme-binding PAS domain 0.043
Further Details:      
 
Weak hits

Sequence:  gi|428312174|ref|YP_007123151.1|
Domain Number - Region: 1256-1329
Classification Level Classification E-value
Superfamily TPR-like 0.00131
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Domain Number - Region: 1247-1284,1889-1932
Classification Level Classification E-value
Superfamily TPR-like 0.0515
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312174|ref|YP_007123151.1|
Sequence length 1940
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNRITVDITGITFKSQIYESVNSLVYRGFRESDGQPIILKMLKQDYPTPDDLSRYQREYE
ITRQLNLEGVVKVYDLQNYQNTLVILLEDFGGESLKRWLSQKPFSLSEFLPIALQITQSL
GQVHHHNIIHKDINPSNLVFNPQTGQVKLIDFGISTVLARENPSLTSPQLLEGTLAYISP
EQTGRMNRSLDYRTDFYSLGVTFYELLTHQLPFQTEEALELVHCHIAKQPVPPHVLEPDI
PKIISDIVMKLMAKTAEERYQSAWGIHRDLAECWHQLQHTGKISTFLLASADISSRFQIP
QKLYGREREVEVLLRAFERVATGEIEVEKEKSEALVSQVSPEKSHIEMMLVAGYSGIGKS
VLVQELYKPITQKRGYFIRGKFDPFQRDVPYSAVIQSLTELVRQVLTESEAELQQWRDKL
LQAFGANGQVIIDVIPEVELIVGSQSPVPTLGATESQNRFNLVFQNFIKVFGSKKHPLVI
FIDDLQWADSATLKLIKLMMTEGVTGTTGEMPTFKKSQHLFFIGAYRDNEVNSIHPLAIA
LEEMRQQGAIINQITLAPLELKHITDLIADTLHSDLSSVKSLAELVLRKTGGNPFFSNEF
LKTLYAENLIRFNLPATSEFESNINHPQNSPWSWDIEQIQAISITDNVLELMLGKLKKLP
EFTQQVLRLAACVGFEFDLKTLSIICEKSTLQVSFELIPAIQSELILAISQLDSQLLIQK
YKFSHDRIQQAAYALINEEDKKIIHLQIGRLLLQNAAPDGLSEKIFKIVDHFNMGIEMIT
KPEERDKIAKLNLRAGQRAKAATAYGVAIKYLNAGFKLLPDNSWETQYELALDLHIEAVE
VEYLNTNYERSAMLSAVVKHQAKTLLEKVRVYEIEIQSEISQNKLQEALQTGLQVIKMLG
VSLPHHPNKLNFWSAQFWTKLQLLGKPIADLKTLPFLIDSHKIAAMRILMNLAAPAYNVN
PALLPLVALKMVNLCIEYGNSPWAAYAYGLYGLMLCNSPKTLDSGYRFGQLSLRILEQFD
ARELKSKVFQVFNSHVRFWKEPLRETIIPLQETVQAGLETGEVEYAGYASAEYCIHLFFS
GENLEFLEQKFSQYGDLIEKINQDFSSHYINIWRQLGLKLLDPNLEQYSLIGECFNETEM
LPIFRRDNTVLFIFSVYLAKTLLCYLFKNKDEALENARLAERYKEGSVGLFKYSVHNFYY
SLVLLSHYPQFTKKEQRKGIQLVSTNQKLMKHWAKHAPCNFQHKYELVEAEKAKVLGKKW
QAAELYKQAIQSARKNGYIQEEALAYELAAEFYLDCGMEEIAQTYMTKAYYGYSCWQALA
KVKDLEKRYPQLISKSVIANRRKNTITKTTSISTSSRSIESLDLASVMKASQAISGEIIL
DKLLASLMKILIENAGAQKGLLILETEGKRLIEASGDVGLNQVTVLQSLPVENSVMVSST
IINYVARTQESVLLNDATHEGQFTLDPYIKAHQPKSILCVPLINQGKLISIVYLENNLTT
GAFTPERLALLKLLSSQAAISIENAKLYTEVRASESRLNQFLEGVPVGVAVFDTTGKPCY
SNRITYQLFGKGVIPETTIEEISKIHHVYKAGTAQEYPTEKLPAVRALKGESVRINDIEI
HREDKIIPIETWGTPIYDEKGNIAYAIVALQDITERKKAEIEREKFTAKLFQLNQSFSRF
VPRQFLQLLDKESIIDVQLGDAVQQEMSVLFSDIRDFTTLSERMTPQDNFKFINAYLSRM
EPAIIEHQGFIDKYIGDAIMALFSGEADNALKAGISMLHRLTEYNQQRMKSGYMPIQIGI
GINTGSLMLGTVGGYNRMDGTVISDAVNLASRVENLTKNYGVSLLITHQTFLQLNEPVYA
IRPIDRVKVKGKSEVVAVYEVFDADPPEVREGKLTTFQIFIEALHNYNSRHFRKAKQLFS
ECLRLNPRDKVAQIYQQRCQ
Download sequence
Identical sequences K9WH54
WP_015183881.1.75295 gi|428312174|ref|YP_007123151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]