SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312175|ref|YP_007123152.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312175|ref|YP_007123152.1|
Domain Number 1 Region: 1570-1754
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-53
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 6-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-53
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 1367-1544
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-25
Family GAF domain 0.0056
Further Details:      
 
Domain Number 4 Region: 295-313,339-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000705
Family RecA protein-like (ATPase-domain) 0.052
Further Details:      
 
Domain Number 5 Region: 1260-1327,1765-1812
Classification Level Classification E-value
Superfamily TPR-like 0.0000759
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312175|ref|YP_007123152.1|
Sequence length 1817
Comment ATPase [Microcoleus sp. PCC 7113]
Sequence
MIKFPGLTVITQIHESANSLVYRGIRQFDQQPIILKLLKEDYPTPSQLIHYRQEYEILRK
LDLEGVVKVYNLQNYQNTLVILLEDFGGESLKRWLGEKSFSLSEFLPIALQITQSLGQVH
HHNIIHKDINPSNLVFNPQTGQVKLIDFGISTVLARENPSLTSPQLLEGTLAYISPEQTG
RMNRSLDYRTDFYSLGVTFYELLTHQLPFQTEEALELVHCHIAKQPVPPHVLEPDIPKII
SDIVMKLMAKTAEERYQSAWGIHRDLAECWHQLQQRGKISTFILASADISSRFQIPQKLY
GREREVEILLRAFERVATGRVDTEEENSEQVISQNPKGKSHIEMMLVEGYSGIGKSVLVQ
ELYQPITQRRGYFIRGKFEQLQRNVPYSAVIQALTELVRQLLAESEVQLQQWREKLLQSL
GSNGQVIIDVIPEVELIVGFQSPVPTLGATESQNRFNLVFQNFIAVFVSPLHPLVIFLDD
LQWADRPSLKLMELLMTSSEPGLFLIGAYRDNEVSSAHPLRLTLKDIKNTGTIVNKIFLK
PLDLITVNQLISDTLNCSGKRTLPLAELVLAKTEGNPFFVNEFLKSLYAENLLNFIPPQP
TLERGEWRWDLEQIKARGITENVVELMAAKIQKLPESTQQVLKLAACIGSRFELKTLAVV
SEKSPQETAVNLHSAVVEGLILPLSDAYEVIGDWESSMTNDQLPITDYQSPIPVEYKFIH
DRIQQAVYSLISEDVEVRHCRARTHRQVGQLLLQNIPANQREEKIFDIVNQLNLGIELIS
DQSERDELAKLNLMAGKKAKASIAYEPAFKYLIFGIELFNPPQSPLDQSSWQRQYNLTLE
LYVEAAEAAYLSTNFEQMEKLAEVVLMQAITLLDKIKIYEILIQSLISQNRLLEAIDTGI
KILRLLGLQFPEKPKILNIIFSLIRIKLTLFRKNIKDLIDLPDMTDPIALAAMRLMWSIS
YAAYLAVPELIPLLAFKMVNLSIKYGNASESASGYAGYGTILCGIIGAIDSGYQLGQLAL
SLLDKFNAKKLKAKTFLVVNDLIRHWKEHLGETLPALIDSFESGIETGDLEFAALSINAY
VYHAYFIGKELGELEQEMAIYSEVIGKLKQETTLYLLKIWRQTVLTLLGRTEHQCRLIGE
VYDEEKMLSLHQEANDRTAIFILYFNKLVLCYLFTEYQEAVKNAAITERYLDGGLGVVTV
PLFHFYDSLALLAIYPSSKTSVQKRILRKVRANQKKMKKWAHYAPANFLHKFYLVEAERC
RVIGQETKAIEWYDYSIAGAEENGYIQEKALAYELAAQYYISKGKDVISKAYMQEARYCY
LKWGATRKVRHLEETYPQLLAATKSGIKNGKFISKSTNQSSGEALDLATIMKATQAISGE
IVLDKLLESLMKILIENAGAQKGFLILESKGKLRIEASGQVDSEKVTVLQSIPIESVEEY
NQTPLLSSTLINYVVRTQESVVLNDATREGQFINDSYIKTHQAKSVLCTPLMNQGKLSGI
VYLENNLTTGAFTPKRIEMLSILSAQAAISIENARLYSNMAALNTAYERFVPRQFLQFLD
KKSIIDVQLGDQIQQEMSVLFSDIRDFTTLSESMTPQDNFKFINSYLSRMEPAIRENQGF
IDKYIGDAIMALFSGAADNALKAGIAMLHRLTEYNQNRMKSGYEPIQIGIGIHTGSLMLG
TVGGYNRMDGTVISDAVNLASRVESLTKIYGIPLLITHQTFLRLSNPSDYKIRKIDEVKV
KGKSELVTVYEVFDADLSEIQEAKLATLELFKEALFHNHSQNWKEAEKLLLECLRLNPND
KVAQFYQQCCRERNSMI
Download sequence
Identical sequences K9WIW3
gi|428312175|ref|YP_007123152.1| WP_015183882.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]