SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312206|ref|YP_007123183.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312206|ref|YP_007123183.1|
Domain Number 1 Region: 456-627
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.27e-47
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 645-767
Classification Level Classification E-value
Superfamily CheY-like 2.28e-32
Family CheY-related 0.01
Further Details:      
 
Domain Number 3 Region: 387-466
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.35e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0014
Further Details:      
 
Domain Number 4 Region: 120-232
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.81e-17
Family Heme-binding PAS domain 0.044
Further Details:      
 
Domain Number 5 Region: 240-363
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Heme-binding PAS domain 0.064
Further Details:      
 
Weak hits

Sequence:  gi|428312206|ref|YP_007123183.1|
Domain Number - Region: 22-86
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0471
Family ABC transporter transmembrane region 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312206|ref|YP_007123183.1|
Sequence length 772
Comment PAS/PAC sensor hybrid histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MLRLRHPQLHTYIMAFLVVALATLLTLMLRSLIEPTFFLLFFAAVAFSAWYGGLGPGILA
TVLTVFVYAYFFIAPFDSWTISLGDIVRLGLFVLVALWISSLSTQLRMAKRRVEVNLLKL
RESEERYRSSQELFESFMQNIPGTAYIKDPQGNYIYINPVGEQLLNRTRMDIVGKTDFDL
VPEAVARQIQAHDIAALAANQPIEAVETVPQLEGNQYWMSFKFPINDASGKSLLAGMSFD
ITDRKQVEEALRQSEERFRIAQELSLDAFTVLRSVRDETEKIIDFEWTYVNPTAARVLNH
TIEELVGQRLLQLLPGNQTNRDLFNRYVQVVETGEPHDLELHYESEGVEGWFRNMAVKLE
DGVAISFSDITKRKQQEAERIELLERERAARAQAETANRVKDEFLAVLSHELRSPLNPIL
GWSKLLRTRPCDQATRERALEIIERNAKLQTQLIEELLDVSRILRGKLSLNPSPVNLQST
IEGAIETVRLAASAKSIQIETVWELDHGQVWGDANRLQQVVWNLLSNAVKFTPTGGRVEI
RLRQSGKQAVIQVSDTGKGISPDFLPFVFDRFRQENSTTTRAFGGLGLGLAIVHHLVKLH
GGTVGVASAGLGQGATFTVMLPLRNLEAIPQTKDGLSLDSPNLEGVRLLVVDDEEDTREL
LLFSLGHYGAQVTAVATAAEALRVLAQLKPDVLLSDIGMPDVDGYMLMRQIRSLPPEQGG
KIKAIAVTAYAGEADHQQIIRAGFQGRITKPIDPAELAKAIASVVGHAVQKA
Download sequence
Identical sequences K9WJS2
gi|428312206|ref|YP_007123183.1| WP_015183913.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]