SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312223|ref|YP_007123200.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312223|ref|YP_007123200.1|
Domain Number 1 Region: 906-987,1016-1103
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.5e-37
Family Histidine kinase 0.0052
Further Details:      
 
Domain Number 2 Region: 212-311
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 612-778
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-26
Family GAF domain 0.0028
Further Details:      
 
Domain Number 4 Region: 333-424
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.08e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 5 Region: 28-158
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000567
Family GAF domain 0.047
Further Details:      
 
Domain Number 6 Region: 455-609
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000807
Family GAF domain 0.0094
Further Details:      
 
Domain Number 7 Region: 814-853,883-914
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000129
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312223|ref|YP_007123200.1|
Sequence length 1114
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKTLLFGNRAISFDQLDPYQGLEANSKAAFDDLTRLAACICQTPIALLCFIDVRRGWVQS
QVGLDPNSTEAYLALCAQTLLQRERWDSRLWVIEDVLADPHWANHEGVTSQANIGFYAGV
PLVMPQGLIVGILAVMDHQPRSLTLKQKKALATLSKQAISLTISGVNMQSERHKSVTSLK
GRTNKRQQQKEAKPTLQQELATLKLVLECTSMVSITDHRGKINYVNDNFCKISQYSREEL
LGKDHRLMNSGYHSSDFFKQMWVTISRGKVWRGEIRNRAKDGNFYWVNTAIVPILNAQEK
PYAYISVCQDITEHKRIENERLSPSQGGTEIFFKFSPDLMCILSGDGHFQQVNPAFEKIL
SYTPEQLLSQPFLDFVHPEDKVATQSVWEKLGSATENIEVENRYRCQDGSYKWQRWNFFC
PVNEHLIYGIGHEVPPHKPGKATLLERSHFSTLEADVAAALGQGSPLVESLKRCTEAMVQ
HLDAIGVGIWLVDSASVGSGDPLPLDLQACAGTLRPANTFPAHVPPNHHLIGTIAQTRQS
LNTQLFVESEEADSAPINFSGYPLMVESRLVGVIALHSRHRFSQVVHNVLGWVANTIATA
IDRAWSRDEFLSRWEALLCQLANQIHNFFDLDIILNTAVTEIWRLLGVDSCHFLWCIEEA
ESPRLTISHEACNPELPCLLGENLPPHLKPIAEIIREQKTLKIEDLRQTGDLNAQTQSLL
CNWGITAGLLLPLKTHTGQLGAIACSHYNGSRQWSDREVELLQAVVDQLAIAIEQTEMFA
NNRAAALAAQTQARHLELALKDLQQTETWLIQTEKMSGLGQMVAGVAHEINNPVNFITGN
LSHATNYIQDLLELINYYKQHYPNPNSEIQGFIEEIDLEFLIEDLPKILSSMKMGADRIQ
EIVLSLRDFSRLDDAQMRPINIHEGIDSTLLILQNRLKPKGKHPGVTVIKEYGNLPPVEC
YAGQINQVFMNILSNAIDALENCTVEGTEQQLFRESQEDIEGHCQINTSSSTHPASTSPT
IWISTELLEDNQAVIRIRDNGLGMPPSVVRRLFDPFFTTKPVGKGTGLGLSISHQIIVEK
HGGLLQCYSEPGQGAEFWIQIPISSSVRTLSAGE
Download sequence
Identical sequences K9WJ41
WP_015183930.1.75295 gi|428312223|ref|YP_007123200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]