SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312266|ref|YP_007123243.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312266|ref|YP_007123243.1|
Domain Number 1 Region: 95-427
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.36e-55
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000202
Further Details:      
 
Domain Number 2 Region: 433-755
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.79e-45
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312266|ref|YP_007123243.1|
Sequence length 757
Comment BNR/Asp-box repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIDWFVIAGRLITGLVIFAVGLTLTNLAYGSITKLGTKKARFLGQTARIAIIILVSLIAL
EQIRSTISIVNIAYGKLQVANVLDYQKNVSLGQRNVFLGGGGYVTGIYLHPLQKDLVYIK
TDVGGFYRWNPDEQSWQPLTDHFPLEQSNYYGGEALALDPNNPDIVYIAAGKFTADWWPD
KGTMFKSTDKGETWTKLNIDLKMGGNEDLRWLGERLAVNPFNSNMILFGSRLDGLWKSLD
AGATWSQVLSFPGKPKADIGITAIAFSKQVLGLVYAIAYGDGIYQSTDSGFTWSKIPGSS
AEAKRLGLASNGVLYVTHSSGVSKYTNGAWSNITPFKTKDTFNAISVNPTNPNNLLVSLG
ENGQSSEIYQSLDGGTTWTKKKKSMNTTVPWWSSYMRSNPWIAAIEFDPQVTDRVWFTDW
YGIWRTEDINANPVTWANYQQGHEEVVTFTLVSPPKGALLLSGVADVDGFYHDKGLDAYP
SKTFGSSGPSFQDTYHIAYCETDPLKMVRVGGNRWNDTYTGTTSIDGGRTWKPFASFPEK
RMLKRIAISATDPNIFIVTTGGGQPVVTTDGGKSWKNVSGLPDGSKGPWDWSQPLAADKV
DGNTFYYYAEGKFYRSTDKGLSFETVNASLPNEWWHSLKTLPGVKGEVWLSLDWQGLYRS
TDGGKTFSKLEKVNRAHLFAFGKPPNGSTIPALYLYGKIAGKGEGIFRSLDRGKTWDFIG
DRQSPIGNNPNVMEASKQQFGLVFIGTNGRGIYYGSQ
Download sequence
Identical sequences K9WJX4
WP_015183973.1.75295 gi|428312266|ref|YP_007123243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]